(data stored in ACNUC7421 zone)

EMBL: AP011115.PE549

AP011115.PE549       Location/Qualifiers
FT   CDS_pept        complement(565979..567364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48796"
FT                   /db_xref="GOA:C1ARW9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW9"
FT                   /protein_id="BAH48796.1"
FT                   /translation="MHRMRRMDRSVAVRHPRRGERHMTDIIDYADKVWKGEANQNAYHH
FT                   GDLRTEGMHCIAEGTYMWPAFGNVYVFPTKAGLFVYDTGDRRTAEDLFAATRRISEQPV
FT                   HTAVYSHGHVDHVFGMEPFDTEARERGWTRPTVLAHENVTRRFDRYKETRGYNGIINQR
FT                   QFQAPNLVWPDEYRYPDVTFADQTTLAVDDLQVQLHHARGETDDAAIAWIPDRKILCCG
FT                   DFFIWASPNAGNPQKVQRFAHEWARTLRWMADLGAEILLPGHGLPVLGADRIRTTLTDA
FT                   AELLEILHGRTLEMMNAGATLDEVVHSVAAPGELLRKPYLAPSYDEPEFVIRNVWRLYG
FT                   GWYDGNPAHLKSAPRADLAREIADLGGGAAQLAERARALLARGEHRLAGHFAQMATDAD
FT                   PQNRDSHQVRVDVFGQLEQGATSTMAKGVYGWAVAESRAFLDGSDHATELKAKTAGRAR
FT                   WAF"
     gtgcacagaa tgaggcgcat ggatcgcagc gtcgcggtcc gacacccacg ccgaggagag        60
     cgccacatga cggacatcat cgactacgcc gacaaggtct ggaagggcga agccaaccag       120
     aacgcctacc accacggaga cctccgcacg gaggggatgc actgcatcgc ggaaggcaca       180
     tacatgtggc cggcgttcgg caacgtctac gtatttccca ccaaggctgg ccttttcgtg       240
     tacgacaccg gcgaccgccg caccgccgaa gacctgttcg cagccacccg gcgaatctcc       300
     gagcaaccgg tgcacacggc ggtctactcg cacggacacg tcgaccacgt cttcggcatg       360
     gaacccttcg acaccgaagc gcgcgagcgc ggttggaccc gccccacggt cctcgcacac       420
     gaaaacgtca cccgccggtt cgaccgttac aaggaaacac gcggctacaa cggcatcatc       480
     aaccaacgcc aattccaggc accgaacctg gtgtggccgg acgaataccg ataccccgac       540
     gtcaccttcg ccgaccagac caccctcgcc gtcgacgacc tgcaggtgca actccatcac       600
     gcccgcggcg agaccgatga cgccgcgatc gcctggatcc ccgaccgcaa gatcctgtgc       660
     tgtggtgact tcttcatctg ggccagcccc aacgccggaa acccgcagaa ggtgcaacga       720
     ttcgcacacg agtgggcccg aaccctgcgg tggatggccg acctgggcgc cgaaatcctc       780
     ctccccggac acgggctccc cgtcctcggc gccgaccgaa tccgcaccac actgaccgac       840
     gccgccgaac ttctggaaat cctgcatggc cgcaccctcg agatgatgaa cgccggagcg       900
     accctcgacg aggtcgtgca cagcgtcgct gcccccgggg aactcctccg caagccctac       960
     ctcgccccct cctacgacga accggaattc gtcattcgca acgtctggcg cctctacggc      1020
     ggctggtacg acggcaaccc cgcacacctc aagtccgccc cccgcgccga cctcgcccgc      1080
     gagatcgcgg acctcggcgg cggcgccgcc cagttggccg agcgggcacg cgccctactg      1140
     gcacgaggcg aacaccggct ggcgggacac ttcgcccaga tggctaccga cgccgatccg      1200
     cagaatcgcg actcgcatca ggtccgcgtc gacgtcttcg gccagctgga acaaggcgcc      1260
     acttccacta tggcgaaagg cgtctacgga tgggcggtgg cggaatcgcg ggccttcctc      1320
     gacggcagcg accacgcgac cgaactgaag gccaaaacgg ccggccgcgc gcgatgggca      1380
     ttctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page