(data stored in ACNUC7421 zone)

EMBL: AP011115.PE55

AP011115.PE55        Location/Qualifiers
FT   CDS_pept        45145..45558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48302"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS53"
FT                   /protein_id="BAH48302.1"
FT                   /translation="MTAAGNGSLKIGNGGFLSIDTVGVAARQHCGTGMLLLTATAIRRR
FT                   PRQDTDSCGGGADMVPAGHIEESIEAGVIATGALLGQDRRRGGQQLRVRRLRRMSSSGY
FT                   CGGVGRHEGPFATSARTAGQVRSARGRGLASHC"
     gtgaccgccg ccgggaacgg ctccctcaag atcggcaatg gcggattcct atccattgac        60
     accgtcggcg tcgcggcgcg gcagcactgt ggcaccggga tgctgcttct caccgccacc       120
     gcgatccgca gacggccacg acaggacacg gacagctgcg gtggtggcgc tgacatggtt       180
     ccggcgggcc acatcgagga gagcatcgaa gccggcgtca tcgctacagg cgcgttgctc       240
     ggccaggacc gccgccgcgg cggacagcaa ctgcgcgtcc gcaggctgcg gcgaatgtcc       300
     tcgtccgggt actgcggagg tgtcggtcgg catgagggtc ctttcgctac atcggcccgt       360
     acagcgggac aggtgaggtc ggcgcggggg cgaggtctcg cgtcacactg ttga             414
//

If you have problems or comments...

PBIL Back to PBIL home page