(data stored in ACNUC7421 zone)

EMBL: AP011115.PE551

AP011115.PE551       Location/Qualifiers
FT   CDS_pept        568812..569990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05510"
FT                   /product="CaiB/BaiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48798"
FT                   /db_xref="GOA:C1ARX1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX1"
FT                   /protein_id="BAH48798.1"
FT                   /translation="MPDSANAPDDLPLAGIMVVDFGQYIAAPGAAQALADLGADVLKIE
FT                   GPGGDQARGIGVYGEAIMRAYNRRKRSIVLDLKTEVDLRHARVLIARADVVIHNLRPGV
FT                   MEKLGLSADEIHELNPTVILAAVSGFGTDGPSRRRPGLDIAAQAETGMMSVTGEADGDP
FT                   QRVGFPLVDHATSYVVTQAVLSALFRRERTGLGDDIDVSLLDVAIDLQCVNWGEYSITG
FT                   VAPHRRGNGQPTAAPAADVFPTADGSIVISAYTEQRFAQLCGLAGQPDLPSDPRFVDNP
FT                   SRVAHRGELLAALAPFFAGLDTEAALAALTSVGIVAGAVRTYDLVPSAPDVIASGIFAT
FT                   GSTGDGHTYSIPGLPYRSRSTPRTADAGRVPELGEHSNEIVAHYRLGEYSLT"
     atgccagact ctgcgaacgc ccccgatgac ctgcccctgg ccggaatcat ggtcgtcgac        60
     ttcggtcagt acatcgctgc gcccggtgcc gcgcaggccc tggccgacct cggcgccgac       120
     gtcctcaaga tcgaaggccc cggcggcgac caggcacgcg ggatcggcgt ctacggcgag       180
     gccatcatgc gcgcctacaa ccggcgcaag aggtcgatcg tcctcgacct caagaccgag       240
     gtcgatctcc gccacgcccg tgtcctcatc gcccgagccg atgtcgtgat ccataacctg       300
     cgaccagggg tgatggaaaa gctcggcctg tcggccgacg aaatacacga actgaatccc       360
     accgtcatcc tcgccgccgt gtccggcttc ggcacggatg ggccctcccg ccgccggccg       420
     ggcctcgaca tcgccgccca ggcggaaaca ggcatgatgt cagtgaccgg agaggccgat       480
     ggagacccgc aacgcgtcgg tttcccgctc gtcgaccatg ccacctccta cgtggtcacc       540
     caggcggtgc tgtcggccct gttccgacga gaacgtaccg gtctcgggga cgacatcgac       600
     gtctcgctgc tcgacgtggc gatcgacctg caatgcgtga actggggcga atactcgatc       660
     accggcgtcg cgccccaccg gcgcggcaac ggacaaccta ccgcggcacc agccgccgac       720
     gtcttcccga ccgctgacgg ctcgatcgtc atctccgcct acaccgagca gcgattcgcc       780
     cagctttgcg gcctcgccgg ccaacctgat ctaccgagtg acccccgctt cgtcgacaac       840
     ccgtcacggg tcgcccatcg cggcgaactc cttgccgcgc tcgcaccgtt cttcgccggc       900
     ctcgacaccg aagccgccct tgcggcgctg acatccgtcg gcatcgtcgc cggcgccgta       960
     cgcacctacg acctggtccc cagcgccccc gatgtgattg ccagcggcat cttcgccacc      1020
     ggcagcaccg gcgacggaca cacatactcc atcccaggcc tcccctaccg ttcccgcagc      1080
     accccccgca ccgcggacgc cgggagggtc cccgaactcg gagaacacag caacgagatc      1140
     gtcgcccact accgactggg cgagtactcc ctgacgtga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page