(data stored in ACNUC7421 zone)

EMBL: AP011115.PE554

AP011115.PE554       Location/Qualifiers
FT   CDS_pept        complement(571759..573165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48801"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX4"
FT                   /protein_id="BAH48801.1"
FT                   /translation="MDAHIVLPTIDGQSFASLRRRATPRAERYALGKRLRQETPRSALG
FT                   EWRAPDDRPDVVDQIGVSHQGRVESLIPVRVGRMAASPYGFLRGTAIVMAQDLAGLPAT
FT                   GIQPVICGDSHLGNFGFYASPERDLVLDLNDFDEAHPGGWEWDLRRLTASIWVAGRQNS
FT                   ATESQCESAVQSCVATYREHVRWLAEQPLLARSFERLDLDRLHTTASDESLRHEITRAA
FT                   ERARRRVSDRALPRFTEQDETGRRIVEEPPLITRVSKAEAERIAAGLDEYLTTLPSHWA
FT                   RLLSGYTVVDVAHKVVGVGSVGLRAYVVLCEGSSADDVVFLQLKQARRSVVARFVHGES
FT                   AWHDHQGRRVVEYQQALQTVSDPLLGWTTVEGRQYYVRQFRNMKGAVPIDNLSAAALTD
FT                   YAGICGRLLAKGHARTSGASMISGYVGKSDTLDVALSRFAHAYADQTERDHATLVDAVK
FT                   RGKLPCEPLT"
     gtggacgcgc acatcgtgtt gccgaccatc gacgggcagt cgttcgcgtc gttgcgccgc        60
     cgggccacgc cgagggcgga gcggtacgca ctgggcaaac gcctgcgtca ggagacaccg       120
     cggtccgcgc tcggcgagtg gcgcgcaccg gacgatcgcc ccgatgtggt ggatcagatc       180
     ggggtgtcgc accagggtcg ggtggaatcg ctgataccgg tcagggtcgg gcggatggcg       240
     gcctcgccgt acggttttct gcgcggcacc gcgatcgtga tggcccagga cctcgccggg       300
     ctgccggcaa ccggcatcca gccggtgatc tgcggggatt cgcatctggg caacttcggt       360
     ttctacgcct cgccggagcg cgacctggtg ctggatctga acgatttcga cgaggcgcat       420
     cccggcggct gggaatggga cctgcgccgc ttgactgcga gcatctgggt ggccggccgg       480
     cagaactcag cgaccgagag ccagtgcgag agtgcagtgc agtcctgcgt cgccacctat       540
     cgcgagcatg tgcgctggct cgcggagcaa ccattgctcg cgcgctcgtt cgagcgactc       600
     gacctcgacc ggctgcacac gacggcgtcg gacgagtctc tgcgccacga gatcacccgc       660
     gccgcggagc gggctcggcg ccgcgtcagc gaccgggcgc tgccccgatt caccgagcag       720
     gacgaaaccg ggcggcgcat cgtggaggag ccgccgctga tcacccgggt gtccaaggcg       780
     gaggccgagc ggatcgccgc cgggctcgac gaatacctca ccacgctgcc cagccactgg       840
     gcacgactgc tcagtggcta caccgtcgtc gacgtcgcgc acaaagtggt cggcgtgggc       900
     agcgtcggac tgcgtgccta cgtcgtgctg tgcgaaggga gcagtgccga cgacgtggtg       960
     ttcctgcagc tcaagcaggc gcgtcgatcc gtcgtggcgc gcttcgtgca cggcgagtcc      1020
     gcctggcacg accaccaggg ccggcgcgtg gtcgagtacc agcaggctct gcagaccgtc      1080
     agcgatccgt tgctcggctg gaccacggtg gagggccggc agtactacgt gcggcagttc      1140
     cggaacatga agggcgcggt cccgatcgac aacctcagcg cggcagcgct gaccgactac      1200
     gccggcatct gcgggcgcct gctcgcgaag ggccacgcgc ggaccagtgg tgcgtcgatg      1260
     atcagcggct acgtcggaaa gtcggacacg ctcgacgtcg cactgagccg gttcgcccac      1320
     gcctacgcgg atcagaccga acgcgaccac gcgactttgg tcgacgcggt gaagcgaggg      1380
     aaattgccgt gtgagccgct gacgtga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page