(data stored in ACNUC7421 zone)

EMBL: AP011115.PE555

AP011115.PE555       Location/Qualifiers
FT   CDS_pept        complement(573571..574827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05550"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48802"
FT                   /db_xref="GOA:C1ARX5"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX5"
FT                   /protein_id="BAH48802.1"
FT                   /translation="MNAISSAGERLTFGAPSSPWLRVGQVGAALAAGMGIGRFVYTPVL
FT                   PLMEAQAGLTPSAGAALATANYSGYLVGALAGIAIPGVMRSAATMRISLLALTVTLALM
FT                   PVASNETSWGVLRFIAGVASALVFVLAVGAMHSHLGGQAAHLSGWAFGGIGAGIALSGF
FT                   VVLVLRTMSTWESVWWAAALLTAICTFAAWTLTPQPRATAAAGERRKSPEQGVRSFGAL
FT                   FVSYLLEGVGYIIAGTFLVAAIDRTAGSIAGSGAWVLVGLAALPSGPLWASLGRRWSRP
FT                   ILLVIALTVQAVGIALPAAADGVWPALVSAFLFGGTFLGISQMSLAIGADLQIPRAVAI
FT                   LTSGYSLGQIVGPLVVTPLLSDGYHLALLVAAGIVLAAALAAAALPVLTWGLPKRAGAT
FT                   ATGAWSDCRSRYRTPPRGG"
     atgaacgcaa tcagtagcgc cggcgagcga ctcacgttcg gggcaccgag ttcgccgtgg        60
     ctcagggtcg gccaggtggg cgcagcgctg gcggccggca tgggtatcgg gcggttcgtc       120
     tacacccctg ttctcccgct gatggaggcg caggccggat tgaccccgtc ggcgggcgct       180
     gccctggcga cggccaacta ttccggatac ctcgtcgggg cgctcgccgg aatcgccata       240
     cccggggtca tgcggtccgc cgcaaccatg cggatctcac tgctcgccct gaccgtcaca       300
     ctggcactga tgccggtcgc atcgaacgaa acatcctggg gtgtattgcg attcattgcg       360
     ggtgtcgcca gtgccctggt gttcgtctta gctgtcggcg ccatgcactc ccacctgggt       420
     gggcaggccg cgcacctgtc gggctgggcg ttcggcggaa tcggagcggg tatcgccctg       480
     tcggggttcg tcgtcctcgt cctgcggacg atgagcacgt gggagtcggt gtggtgggcg       540
     gccgcgctcc tgactgcgat ctgcaccttc gcggcgtgga ccctgacacc gcaacctagg       600
     gcaaccgcgg cggccggaga gcgcagaaag tcacctgagc agggggtccg ctcgttcggt       660
     gcactcttcg tcagctattt actcgagggc gtcggataca tcatcgccgg caccttcctc       720
     gtcgcggcga tcgaccggac cgcgggcagc atcgccggca gtggtgcctg ggtgctggtc       780
     gggttggcgg cgctgccctc cggtccactg tgggcgtcgc tcggccgacg atggtcccgt       840
     ccgatcctgc tggtgatcgc cctcaccgtt caggccgtcg gcatcgcgct gcccgcggcg       900
     gcagacggcg tctggcccgc gctggtctcc gccttcctgt tcgggggaac cttcctcggc       960
     atcagtcaga tgtcgctcgc gatcggcgcc gacctccaaa tcccgcgcgc ggtagcgatt      1020
     ctgacgagcg ggtacagtct cggacagatc gtcggcccgc tcgtcgtgac accactgctg      1080
     tccgacggct accacctcgc actgctcgtc gccgcgggta tcgttctcgc cgcggcactt      1140
     gcggccgccg cactgcccgt cctcacgtgg ggcctgccga aacgagccgg agccaccgcc      1200
     acaggagcgt ggtcggattg tcgaagtcga taccgaactc ctccgcgagg cgggtga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page