(data stored in ACNUC7421 zone)

EMBL: AP011115.PE56

AP011115.PE56        Location/Qualifiers
FT   CDS_pept        46705..47097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48303"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS54"
FT                   /protein_id="BAH48303.1"
FT                   /translation="MFAIVARFSVLWIDEVGMASVRDRTHPAARLHFKCAGTGSAGAPV
FT                   PDPPHRMIAHTHVLLTPLDRAPRTFDQPLTWNAVPPAAVGGTAPRGLDGGGATDSAGEN
FT                   KQEQGDIEVHGTGPSRGAECCCRCGS"
     gtgttcgcca tcgtggcgag attttcagtg ctatggatcg acgaggtcgg catggcatct        60
     gtccgggacc gcacgcaccc ggcggcacgt ttgcacttca aatgcgccgg cacgggatcc       120
     gcgggagcgc ccgtaccaga cccaccccat cgcatgatcg ctcacacgca tgtcctcttg       180
     accccgttgg accgggctcc gagaacgttt gatcagccgt tgacgtggaa cgccgtgccg       240
     ccggccgcgg tcggcggcac ggcgccacgc ggcctggacg gcggcggtgc caccgattcc       300
     gccggcgaga acaagcaaga gcagggcgac attgaggttc acgggacagg tccttctcgg       360
     ggggcagaat gttgctgccg gtgcggatcg tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page