(data stored in ACNUC7421 zone)

EMBL: AP011115.PE562

AP011115.PE562       Location/Qualifiers
FT   CDS_pept        complement(581181..581921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48809"
FT                   /db_xref="GOA:C1ARY2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY2"
FT                   /protein_id="BAH48809.1"
FT                   /translation="MTIERLLTTHFPDDPVMDAAFASALLRRTGRDPNAPGLVRIYSPA
FT                   RTLSFGRLDAIRPQFPAAAAAARRHGFTPVVRGAGGRAAAYHEQTLVVEIFSRDTEGII
FT                   GARPRFERITPRIAAVLRSLGVDARIGPVPGEYCPGDWTVNGEGRVKLAGTAQRIVAGA
FT                   WLFGFELVVSDSNPVRAVLTDVNAALELDFDPGTAASLTDMNPGVTLEQVRAAILAETG
FT                   GLHERAADPGLLDEAANLRDAHVA"
     atgacgatcg agcggttgct gaccacgcat tttccggatg atcccgtgat ggatgcggcg        60
     tttgcgtcgg cgctgctgcg ccggacgggg cgagatccga atgctcctgg gctggtgcgg       120
     atctacagtc ccgcacggac gttgtcgttc gggcggttgg acgccatccg accgcagttt       180
     ccggcggccg ccgcggcggc gcggcgacat gggttcaccc ccgtcgtccg aggggccggt       240
     ggtcgggccg cggcctacca cgagcagacc ctcgtcgtgg agatcttctc ccgggacacc       300
     gagggcatca tcggcgcccg cccgcgcttc gagcggatca ccccgaggat cgccgccgtg       360
     ctgaggagcc tcggcgtcga cgctcgcatc ggaccggtcc ccggcgagta ctgccccggt       420
     gactggaccg tcaacggcga gggccgtgtc aagttggcgg ggaccgcgca gcgaatagtc       480
     gccggcgcgt ggctcttcgg tttcgagctc gtggtgtccg attcgaatcc cgtgcgagcg       540
     gtgctcaccg acgtcaacgc cgccctcgag ttggacttcg acccgggcac ggcggcgtcg       600
     ctcacggaca tgaacccggg cgtcaccctc gaacaggtcc gggccgcgat ccttgccgag       660
     accggcggac tccacgaacg agccgcggac cccggcctcc tcgacgaggc cgcgaacctg       720
     cgcgatgcgc acgtggcgtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page