(data stored in ACNUC7421 zone)

EMBL: AP011115.PE563

AP011115.PE563       Location/Qualifiers
FT   CDS_pept        582148..582585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48810"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY3"
FT                   /protein_id="BAH48810.1"
FT                   /translation="MLLRSSVVALPCAVAAVLSASPAQATPSSGVTAQILFETTVPAVA
FT                   GSSAGTDLTLRRIEIASGGTTGWHYHDGPVYAFVESGVLSRTLQDCTKAVTTAGQAITE
FT                   DHGSDHVHEGSNLGTEPLVLLAFYTQPEGKPLSEDAPAPAC"
     atgctcctca gatcgagtgt ggtcgccttg ccctgtgccg tcgccgcggt actgtccgcc        60
     tcgcctgccc aggccacgcc gtcttcgggc gtgaccgctc agattctgtt cgagaccacg       120
     gttccggcgg tcgccggcag ttcggcgggc acggatctga cgctgcggcg catcgagatc       180
     gcctccggcg gcacgacggg ctggcactac cacgacggcc cggtgtatgc gttcgtcgag       240
     tcgggggtgc tgtcccgcac gctgcaggac tgcacgaaag cggtgacgac cgccggtcag       300
     gcgatcaccg aggaccacgg cagcgaccac gtccacgagg gttccaatct ggggaccgaa       360
     ccgctggtcc tgctcgcgtt ctacacccaa ccggagggca agccgctgtc cgaggatgcg       420
     ccggcaccgg cctgctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page