(data stored in ACNUC7421 zone)

EMBL: AP011115.PE568

AP011115.PE568       Location/Qualifiers
FT   CDS_pept        586130..586543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48815"
FT                   /db_xref="GOA:C1ARY8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY8"
FT                   /protein_id="BAH48815.1"
FT                   /translation="MDRTPSTPIRLPDAALAFLGEYHLGTLTTLRKNGTPHVVAVGFTW
FT                   DQEHGLARVITNGSSQKALNAERGGYGAVSQVDGPRWMTLEGPARVLTDPESVADAVAR
FT                   YAARYRQPRVNPTRVVVEIAVSRVLGSAALRHD"
     atggaccgca ccccctccac cccgatccgc ctgcccgacg cggcactcgc cttcctcggc        60
     gaataccacc tcgggacgct caccacgctg cgcaagaacg gcaccccgca cgtcgtcgcc       120
     gtcggcttca cctgggatca ggagcacggg ctggcgcggg tcatcaccaa cggctcctcc       180
     cagaaggccc tcaacgccga acggggaggg tacggcgccg tcagtcaggt ggacggaccg       240
     cgctggatga cactcgaagg tcccgcccgg gtcctcaccg accccgaatc cgtcgccgac       300
     gccgtcgccc gctacgccgc gaggtaccgc cagccccggg tgaacccgac acgggtggtc       360
     gtggagatcg ccgtcagccg cgtactcggc tcggctgcgc tgcgtcacga ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page