(data stored in ACNUC7421 zone)

EMBL: AP011115.PE57

AP011115.PE57        Location/Qualifiers
FT   CDS_pept        complement(47795..48211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48304"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS55"
FT                   /protein_id="BAH48304.1"
FT                   /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGAEVGWVA
FT                   SPLTRDEVVDASMFLFKENYVTGVPVMGIGIPRPMLTVAGRRVAKAGKPLRYKVDAHEA
FT                   KVRRHLGGTAGRDIRDDDGGSEVKERMARPVTRR"
     gtgagtgcag ctaccgatcg tcagtgggcg gttcgtgacg ctgttctgcg ttggcttctt        60
     gcgaagacaa cggagggtta tcgcagcccg attctggacg cggatgccat cggagcagag       120
     gtcgggtggg tggcttcgcc gctcacccgc gacgaagtgg tcgacgcctc gatgttcctg       180
     ttcaaggaga actatgtgac aggcgtgccg gtgatgggta tcgggattcc acgaccgatg       240
     ctgactgtcg cgggacgtcg ggtggccaag gccggaaaac cgctgaggta caaggtcgac       300
     gctcacgagg cgaaggtgcg ccggcatctg ggcggaaccg ctggcagaga catccgcgac       360
     gacgacggcg gcagtgaagt gaaagagaga atggctcgac cggtcactcg acgatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page