(data stored in ACNUC7421 zone)

EMBL: AP011115.PE576

AP011115.PE576       Location/Qualifiers
FT   CDS_pept        complement(594568..594834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48823"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ6"
FT                   /protein_id="BAH48823.1"
FT                   /translation="MGRERVGAEIRDHGLRLTDLHGSDIEVGASDIAFDTGPGTAAPVN
FT                   ARLVALIREAEAGGNRQWSGEALLADLRSQRGPRKPAGKRQRS"
     atgggccggg agcgtgtcgg ggcggagatc cgtgaccacg ggttgagact gacggacctg        60
     cacggatcgg acatcgaggt cggtgcctcc gacatcgcct tcgacaccgg gcccgggacg       120
     gcggcgcccg tgaacgcgcg tctggtcgcg ctgatccgcg aggccgaggc gggcgggaac       180
     cggcagtggt ccggggaggc cctgctcgcc gatctgcgct cacagcgggg acccaggaaa       240
     cccgcaggga aacggcagcg cagctag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page