(data stored in ACNUC7421 zone)

EMBL: AP011115.PE58

AP011115.PE58        Location/Qualifiers
FT   CDS_pept        49076..50764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48305"
FT                   /db_xref="GOA:C1AS56"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS56"
FT                   /protein_id="BAH48305.1"
FT                   /translation="MCRELMEQKMNRPGLVTRRPAPASLSSKRGRAMLRVILLPLDIVE
FT                   SADPVPVPAVDEVEPFLPARISAPTATGDDGPQAQLLAFRHIVDRRSPPVTFGLALDGQ
FT                   RAPDGRRRPYVGPPATCLSLWEVPGNGLVLACEELTPDRAGSLIDRHHDPLRGGGSPEF
FT                   WAAIEAFLRPFGLTPDASPMDVFPRLNTRLPSSAVYRPLRSLTIHGPHRTDSDTLEGLI
FT                   IEVHTDGVDTVRRLVDEPGTSPCGGAASRSYRGLLRWHRVPLIDRASRLGSGIAIREDA
FT                   RALAVDVGAPVIGRQYVDRGTREMLYCLIGWVALRAQHSADHRRVLSLLRNRRQLSEGG
FT                   ALAGLGDIAAARTRMIETRLLQAHPADDHRLPPRIESTHLRSTLVHRTADEIAFLHTEL
FT                   GKLCDSAESSLLPHAVASARERRSTLVSVAAAGALFVTSLHAAVAASPVDLQRWGFTVA
FT                   VAAAIGAVALLEVVSRRRPSRTPLKPTPVAPPHASPVVTPVRDLERRRLESIFPFETQV
FT                   WRTVPSRRGMTPTFRECLEANDLSVGEPSNSLLVMASPTFRPAPK"
     atgtgtcgag aattgatgga acaaaaaatg aatcgtcctg gactcgtcac ccgccggccg        60
     gccccggctt cgctgtcgtc gaagagaggc cgggcaatgt tgcgcgtcat cctgctgccg       120
     ttggatatcg tcgaaagcgc cgacccggtc ccggtacccg cggtcgacga ggtcgaaccg       180
     ttcctgcctg cccgcatcag cgcccccacc gccaccggag acgatggacc ccaagcacag       240
     ttgctggcgt tccggcacat cgtcgaccgc aggagtcccc cggttacctt cggcctcgca       300
     ctcgatggac agcgcgcacc tgacggtcgg cgtcgcccct acgtcggccc gccggccacg       360
     tgcctgtcac tgtgggaggt gcccggcaac ggactggtgc tggcctgcga ggaactcacc       420
     cccgaccgcg ccggcagcct gatcgaccgg caccatgatc cgctccgcgg cggcggtagc       480
     cccgaattct gggccgccat cgaagcattc ctccgcccct tcgggttgac gcctgatgcg       540
     agcccgatgg acgtcttccc gcggctgaac acccgactgc ccagctccgc ggtctaccgg       600
     ccgctgcgca gcctgacaat ccacggccct caccggactg attcggacac cctcgagggc       660
     ctgatcatcg aggtccacac ggacggggtc gatactgtac ggcgactggt cgatgaaccg       720
     ggcacctcac cctgcggcgg ggccgcgtcc cgctcctacc gtggactctt gcgctggcac       780
     cgggtcccgc tgatcgacag ggcgtctcgt ctcggatcgg ggatcgcgat tcgcgaggac       840
     gcccgagccc tcgccgtcga cgtcggcgcc cccgttatcg gtcgccaata tgtcgatcgg       900
     ggcacccgtg agatgctcta ctgcctcatc ggctgggtcg ccctgcgcgc acagcactcg       960
     gcggaccacc gacgcgtcct gtcgctcctg cgcaaccgcc gccaactgag cgagggtggc      1020
     gccctcgcgg gcctcggcga catcgcggcg gcccgcacac ggatgatcga gacacggctt      1080
     ctgcaagcac accccgccga tgatcaccgc ctcccgccac ggatcgaatc gacacacctt      1140
     cgatcaacgc tggtgcaccg caccgccgac gagatcgcgt ttctgcatac cgaactcggt      1200
     aagctgtgtg acagtgctga aagcagtctg ctgcctcacg cggtcgcctc cgcccgagaa      1260
     cggcggtcca cgctcgtgtc ggttgcggcc gccggtgcgc tgttcgtgac ctcgctccac      1320
     gcggccgtcg cggcatcgcc ggtggacttg cagcgctggg ggttcaccgt ggcggttgcc      1380
     gccgcgatcg gcgctgtcgc cttactcgag gttgtctcac gtcgtcgccc ctccaggaca      1440
     ccactgaaac cgacaccggt cgcgccgccg catgcctcgc ccgtcgtgac gccggtcagg      1500
     gacctcgaac gccgacggct ggagtcgatc ttcccgttcg agacgcaggt gtggcgcacc      1560
     gttccgagtc gccgcggcat gacgcccacg ttccgagagt gcctcgaggc caacgatctt      1620
     tccgtcggcg agccttccaa ctcactgttg gtgatggcaa gtccgacatt ccgtccagca      1680
     ccaaaatag                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page