(data stored in ACNUC7421 zone)

EMBL: AP011115.PE580

AP011115.PE580       Location/Qualifiers
FT   CDS_pept        598293..599756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48827"
FT                   /db_xref="GOA:C1ASP5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP5"
FT                   /protein_id="BAH48827.1"
FT                   /translation="MNRHLHRIHRVDEIVFGRSADLRPSGVDRAMRFLSHAADKGVLWW
FT                   CVAALLGLVGGRARRGAVRGLLSLAMASGLANGILKPVFPRRRPPARAWTNVLRGVPIP
FT                   RSSSFPSGHSASAAAFTTGVALESPAAGAALAPLAAAVAYSRVHNGVHWPSDVLVGLML
FT                   GGAVASGTRRWWAVRTEDPAELGPAVDAPALPGGEGLLVLVNQESGPDTVDPSEEIATA
FT                   LPKAHVRALDTDRDFAEQLDAWVAETNPRALGVCGGDGTVVAVASAAARHTLPLAVFPG
FT                   GTLNHFARDAGVPEISDTATAVETGHAVLVDQAVVHTDVAEPAPFLNTASLGGYPDAVR
FT                   LREKWQPRYGKWPAACAAMIRILAAATPLAVTLDGRPVNVWMLFVGNGRYSPGDQVPMS
FT                   RPAITGGLLDVRYVRADRRASRPRLLFAAVTGTLGSSRVYVRSLVPRLTVRVNGAPVAL
FT                   ATDGEVVTDARRFEFRTVPGAIAVYRPQS"
     gtgaaccgac acctgcaccg catccaccgg gtcgacgaga tcgtgttcgg ccgcagcgcc        60
     gatctccgcc cgtccggggt cgaccgggcg atgcgcttcc tcagccacgc ggccgacaag       120
     ggggtcctgt ggtggtgtgt ggcggcactg ctgggactgg tcggcggacg tgcccggcgc       180
     ggtgccgtgc ggggcctgct gtcgctcgcg atggcgagcg gtctggccaa cggcatcctc       240
     aagccggtgt tcccacggcg gcgccctccc gcccgcgcgt ggacgaacgt gctgcgcggc       300
     gtgccgattc cccggtcctc gtccttcccg tcgggacatt cggcgtcggc ggcggcgttc       360
     accaccggtg tcgccctgga atcgcccgcg gccggtgccg cactcgctcc cctcgcggcc       420
     gcggtcgcgt actcccgggt gcacaacggc gtgcactggc cgtcggacgt cctcgtcggg       480
     ctgatgctgg gtggggccgt cgcttccgga acccgccgct ggtgggcggt gcgcaccgaa       540
     gacccggcgg agctgggccc cgcagtcgac gcgccggcgc tgccgggcgg tgaaggcctc       600
     ctcgtactgg tgaaccagga gtccgggccg gacaccgtgg atcccagcga ggagatcgcg       660
     accgcactcc cgaaggctca cgtgcgcgcc ctcgacaccg accgcgattt cgccgagcaa       720
     ctcgacgcct gggtggccga gacgaatccg cgggcactcg gggtgtgcgg cggagacgga       780
     accgtggtcg ccgtcgcatc tgcggcggcg cgtcacaccc tgccactggc ggtgttcccc       840
     ggcggcacac tcaatcactt cgcgcgggac gccggcgttc ccgagatctc ggacacggca       900
     acggccgtcg agaccggaca tgcggttctc gtggatcagg ccgtcgtcca caccgacgtc       960
     gccgaacccg cgccgttcct caacaccgcc agtctcggtg gctatccgga cgcggtgcga      1020
     ctacgggaga agtggcagcc ccggtacggg aagtggcccg cggcctgtgc ggcgatgatc      1080
     agaattctcg ccgcggcgac accgctcgcc gtcaccctcg acggcaggcc cgtgaacgtc      1140
     tggatgctgt tcgtggggaa cggtcggtac tcccccggcg atcaggttcc gatgtcgcgc      1200
     ccagccatca ccggcggact gctcgacgtc cggtacgtgc gagccgaccg gcgggcgtcc      1260
     cggccgcggc tgctgttcgc cgccgtgacc gggacgctcg gaagcagccg ggtgtacgtg      1320
     cgatccctcg tgccccggct caccgtccgg gtgaacggcg cacctgtcgc gctggccacc      1380
     gatggtgaag tggtgaccga cgcccggagg ttcgagttcc ggacggtgcc cggagcgatc      1440
     gccgtgtacc gacctcagtc ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page