(data stored in ACNUC7421 zone)

EMBL: AP011115.PE585

AP011115.PE585       Location/Qualifiers
FT   CDS_pept        complement(603342..603719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48832"
FT                   /db_xref="GOA:C1ASQ0"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ0"
FT                   /protein_id="BAH48832.1"
FT                   /translation="MALPRSIARFNRVVTNRVSRHVASILPGFAMVEHRGRKSGKSYHT
FT                   PVNVFVVDGRYRFALTYGARSDWVRNVVAAGGCTIVTRRRTVHLTDPRIGTDGTHSWAP
FT                   PGVRTVLEAISADQYLECSPG"
     atggcgttgc cgcgttcgat cgcccgtttc aaccgggtcg tcaccaaccg ggtgagccgt        60
     catgtcgcga gcatcctgcc cggtttcgcc atggtcgagc accggggccg gaagtcgggg       120
     aagtcgtatc acacacccgt caacgtgttc gtcgtggacg gccgctaccg gttcgccctc       180
     acatacggag cgcgcagcga ctgggtgcga aacgtggtgg cggcgggcgg atgcaccatc       240
     gtgacgcgtc gccggacggt gcacctgacg gaccctcgaa tcggcaccga cggcacccac       300
     tcgtgggccc cgcccggggt ccggaccgtg ctcgaggcga tctcggcgga ccagtacctg       360
     gagtgctcgc cgggctag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page