(data stored in ACNUC7421 zone)

EMBL: AP011115.PE588

AP011115.PE588       Location/Qualifiers
FT   CDS_pept        606379..606882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48835"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ3"
FT                   /protein_id="BAH48835.1"
FT                   /translation="MIIRKPLNGRSFTGRSAVAVGAVVFALGMSACSSDDASDTAAATS
FT                   AATSSAAEAAVAAPTSEELLGTLQLLVDPARPVDEKTVVVVDGDERRPNLEAMTAAMAN
FT                   YPVSFTVTDVQVEGDTATANVAIVSPHGTAAPTAWTWENVDGVWKVSDESTCTLLGMAR
FT                   AGCS"
     gtgataatcc gcaagcccct gaacggcaga tccttcaccg gtaggtccgc ggtcgccgtc        60
     ggcgcggtgg tcttcgcgct cgggatgtcg gcctgctcgt cggacgacgc ttccgacacc       120
     gctgcggcga cgtccgcggc cacgtcgtcc gcggcggaag cggcggtcgc ggcccccacg       180
     tccgaggaac tgctcggtac gctccagctg ctcgtggacc cggcccggcc ggtcgacgag       240
     aagaccgtcg tggtcgtcga cggcgacgaa cgccgcccga atctggaggc gatgaccgcc       300
     gccatggcca actacccggt gtccttcacg gtcacggacg tgcaggtgga gggcgatacc       360
     gcgacggcga acgtcgcgat cgtgagcccg cacggcacgg ccgccccgac ggcgtggacg       420
     tgggagaacg tcgacggcgt gtggaaggtg tcggacgaga gcacgtgcac cctgctgggc       480
     atggcacgcg cgggctgcag ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page