(data stored in ACNUC7421 zone)

EMBL: AP011115.PE59

AP011115.PE59        Location/Qualifiers
FT   CDS_pept        50864..51622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00590"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48306"
FT                   /db_xref="GOA:C1AS57"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS57"
FT                   /protein_id="BAH48306.1"
FT                   /translation="MLVTSYPSWWQMLAVLSVAVVLSTAVGMERQLRQKSAGMRTHTLV
FT                   GLGAALFMIVSKYGFSDVLTEGLVTLDPSRVAGQIVSGIGFIGAGLVFVRRNKVRGLTT
FT                   AASIWLTAAIGTASGAGLILPAMFVTGCHFVIAFAYPVVVRYSRLGKSSQHLLRVRYAD
FT                   GTGALRRIISACTEHGLAVQGFATRHPDADAGAGGVLTRLRDNLDTAMPLASGVEVELE
FT                   LYGTTNLSELMTQLSVLDHVDGVHCDDPLE"
     atgctagtga cctcgtaccc gtcctggtgg cagatgctgg ctgtgttgtc ggtggccgtg        60
     gtgctgtcca cggcggtggg catggagcgg cagttgcggc agaagtccgc cgggatgcgt       120
     acccataccc tcgtcggtct cggggctgca ttgttcatga tcgtcagcaa gtatgggttc       180
     agcgacgtcc tcaccgaagg cctggtcacg ctcgacccct cgcgggtggc cggccaaatc       240
     gtctccggaa tcggtttcat cggcgccgga ctggtcttcg tccgccgcaa caaggtccgc       300
     ggactgacca ccgcggcgtc gatctggctc accgccgcaa tcgggaccgc atccggtgcc       360
     gggctgatcc ttccggcgat gttcgtcacc ggctgccact tcgtcatcgc cttcgcgtat       420
     ccggtcgtcg tccgttacag ccggctcggc aagtccagcc agcacctgct acgcgtgcgg       480
     tacgccgacg gcaccggcgc actccggcgc atcatctccg cttgcacgga gcacgggctc       540
     gccgttcagg gcttcgccac ccgacacccc gatgccgacg ccggcgccgg cggcgttctc       600
     acccgtctgc gcgacaatct ggacactgcg atgccactcg ccagcggcgt cgaagtcgaa       660
     ctcgaactgt atggaaccac gaacttgagc gaactgatga cgcaactatc ggtcctcgac       720
     cacgtcgacg gagtccattg cgacgaccca ctggaatag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page