(data stored in ACNUC7421 zone)

EMBL: AP011115.PE590

AP011115.PE590       Location/Qualifiers
FT   CDS_pept        607881..608786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48837"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ5"
FT                   /protein_id="BAH48837.1"
FT                   /translation="MSISESPAPVTKGSPSQPGDTSATRRRPALSPSRAGDFKQCPLLY
FT                   RFRAVDRLPEAPSRAQVKGTVVHAALETLFGLPAAERVPARAVDLVRPSWERLLDEAPD
FT                   LIDLVPVDQRESFLDEARSLVTAYYQLEDPTRFEAESCEQRVETELADGVLLRGFVDRI
FT                   DVAPTGEVRVVDYKTGRAPREMSESKALFQMKFYALVLLRTRGIVPAQLRLLYLASGTV
FT                   LTYAPDEDELLRFERTLSAIWKAILAAGVTGDFRPKPSRLCDWCDHKSLCPSFGGTPPP
FT                   YPGWPEGPAEDAPGFEEIVE"
     gtgagcatct cagagtcgcc agcccccgtc acaaagggtt ccccatcaca gcccggcgac        60
     acttcggcca cccgcaggcg ccccgccctg tcaccgtcgc gtgccggcga cttcaagcag       120
     tgcccgcttc tctaccgctt ccgcgccgtc gaccggcttc ccgaggcgcc gtcacgcgca       180
     caggtgaagg gcacggtggt gcacgccgcg ctggagacgc tgttcgggct ccccgccgcc       240
     gagcgggttc ctgcgcgcgc cgtcgacctc gtccgcccgt cgtgggagcg cctcctggac       300
     gaggctcccg atctgatcga tctggtcccc gtcgaccagc gcgagtcgtt cctcgacgag       360
     gcgaggtcgc tcgtcaccgc gtactaccag ctggaggacc ccacccggtt cgaggccgaa       420
     tcgtgcgaac agcgcgtcga gaccgaactc gccgacgggg tgctgctccg cggattcgtc       480
     gaccgcatcg acgtcgcccc caccggggag gtgcgggtgg tcgactacaa gaccggtcgc       540
     gcaccccgcg agatgtccga gtccaaggcg ctgttccaga tgaagttcta cgcgctggtc       600
     ctgctgcgca cccgcggcat cgtcccggcg cagctgcggc tgctgtacct cgcgtccggg       660
     acggtcctca cctacgcgcc cgacgaggac gaactgctgc gcttcgagcg cacgctgtcg       720
     gcgatctgga aggccatcct ggccgcgggt gtcaccggcg atttccgacc caagccgagc       780
     cggctctgcg actggtgtga tcataagtcc ctgtgcccct cgttcggcgg aacgccgcct       840
     ccctacccgg gatggccgga ggggcccgcc gaagacgcgc cgggtttcga ggagattgtc       900
     gaatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page