(data stored in ACNUC7421 zone)

EMBL: AP011115.PE591

AP011115.PE591       Location/Qualifiers
FT   CDS_pept        608783..609619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48838"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ6"
FT                   /protein_id="BAH48838.1"
FT                   /translation="MSSESYYVPVGSEALGAPTPGSDQKVVVERFASTDLTISVWADTM
FT                   QHGAPPSALLVRALERCAAREDARLTRVVVEILGPIPIAELEVRSWVQRPGRRVELVVA
FT                   ELWTVGDRPRAVARGSAWRMETVDTSDAVHVVDPPLEPRSTGRDGAFGGIWNSGYLTTL
FT                   DWRWIAEMGCEGPGKLWAKPRPALVLGETMTPLERLFAIADIANGVGSKLDPAQWTFLN
FT                   TDLTVHIFRVPEGDWVGVSSETSIGPDGVGMCAGVLYDETGAVGRIAQTVQVRARP"
     atgagttccg agtcctacta cgtaccagtc ggttcggagg cactgggtgc cccgacgccg        60
     ggctcggacc agaaggtcgt cgtcgaacgg ttcgccagca ccgacctgac gatcagcgtg       120
     tgggccgaca cgatgcagca cggcgctccc ccgtcggcgt tgctcgtgcg ggcgctggaa       180
     cggtgcgccg cacgcgagga cgcacgcctc acccgggtgg tggtcgagat cctgggcccc       240
     atcccgatcg ccgaactgga ggtccggtcc tgggtgcagc gaccgggacg ccgggtggag       300
     ctggtggtcg cggaactgtg gaccgtcggc gaccggcccc gtgccgtggc gcgaggctcg       360
     gcctggcgca tggagaccgt cgacaccagc gacgccgtcc acgtcgtcga cccgcccctc       420
     gaaccgcgat ccacgggccg ggacggcgcg ttcggcggca tctggaactc cggctacctg       480
     accaccctcg actggcggtg gatcgccgaa atggggtgcg agggaccggg caagctgtgg       540
     gcgaagccgc ggcccgccct ggtgctcggc gagaccatga cgccgctcga gcggctgttc       600
     gccatcgcgg acatcgccaa cggcgtggga tcgaagctcg atccggcgca gtggacgttc       660
     ctcaacaccg acctcaccgt gcacatcttc cgggtgcccg agggcgactg ggtgggcgtc       720
     agctccgaaa cctccatcgg ccccgacgga gtgggcatgt gcgcgggcgt gctctacgac       780
     gagaccgggg ccgtgggccg gatcgcccag accgtgcagg tccgcgcccg cccctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page