(data stored in ACNUC7421 zone)

EMBL: AP011115.PE595

AP011115.PE595       Location/Qualifiers
FT   CDS_pept        complement(611769..612626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48842"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASR0"
FT                   /protein_id="BAH48842.1"
FT                   /translation="MAVPKIVLFYVFTPLADPEAIRLWQYTLAEAHDLTGRILVSEHGI
FT                   NATVGGDIRDVKRYVKGTRSYAPFKDADIKWSDGLGNDFPRLSVKVRPEIVTFGAPGEL
FT                   KVDADGVVGGGTHLAPEEVHRLVEGRGDDVVFFDGRNGFEAEIGRFRDAVVPDVSTTRD
FT                   FVHELDSGKYDHLKDKAVVTYCTGGVRCEVLSSLMRSRGFGEVYQLDGGIVRYGEAFGD
FT                   TGLWEGSLYVFDKRMTIEFSDQAKTLGRCTRCGGPTSRYENLPDDRGRELVLVCAGCTE
FT                   NRAG"
     gtggctgtcc cgaaaatcgt gctgttctac gtgttcactc cgctcgccga cccggaggcg        60
     atccggctgt ggcagtacac gctcgccgag gcacacgacc tgaccggacg gatcctcgtc       120
     tccgagcacg gcatcaacgc gaccgtcggc ggcgacatcc gcgacgtcaa gcggtacgtg       180
     aagggcacac gcagctatgc gccgttcaag gacgccgaca tcaagtggtc ggacgggctg       240
     gggaacgact tcccgcggct cagcgtcaag gtgcggccgg agatcgtgac gttcggtgcg       300
     ccgggggagc tgaaggtgga cgcggacggc gtcgtcggcg gcggcaccca cctggcgccg       360
     gaagaggtgc accggctggt cgagggccgc ggcgacgacg tcgtcttctt cgacgggcgc       420
     aacggtttcg aggccgagat cggccgattc cgggatgccg tcgtgccgga cgtgtccacc       480
     acccgcgact tcgtgcacga actcgacagc ggcaagtacg accatctcaa ggacaaggcc       540
     gtcgtcacct actgcaccgg gggagtgcgg tgcgaggtcc tgtcctcgct gatgcgctcg       600
     cgcggattcg gtgaggtcta ccaactcgac ggcggcatcg tccgctacgg cgaggcgttc       660
     ggtgacacgg gtctgtggga ggggtcgctg tacgtcttcg acaagcggat gaccatcgag       720
     ttcagcgatc aggccaagac cctgggacgt tgcacccgat gtggcggtcc gacgtcccgg       780
     tacgagaatc tgccggacga ccggggccgc gaactcgtgc tcgtgtgcgc cggctgcacc       840
     gagaaccggg cgggctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page