(data stored in ACNUC7421 zone)

EMBL: AP011115.PE598

AP011115.PE598       Location/Qualifiers
FT   CDS_pept        616948..617889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48845"
FT                   /db_xref="InterPro:IPR008492"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR3"
FT                   /protein_id="BAH48845.1"
FT                   /translation="MSSSEFPVTPAGPDDDTPDTADDGATDSGVPVLRDPVLVAAFEGW
FT                   NDAGDAASGAVEHLELTWDAQPLAELDSEEYYDYQVNRPTVRQVDGVTREIVWPATRLS
FT                   VCSPPGSDRDVVLLRGIEPNMRWRSFCEDLLELIDQLQINTVVILGALLADTPHTRPVP
FT                   VTGSAYSSEAAERFKIEQTRYEGPTGITGVLQDACVRAGVPAVSFWAAVPHYVSQPPNP
FT                   KATVALLQRVEDVLDIEVPLGELPSQADDWQEAVTEMTADDEEIGDYVRSLEERGDAET
FT                   DISEAISKIDGDALAAEFERYLRRRGPGSFGL"
     gtgagttcca gtgagttccc cgtcacgcct gcgggccccg acgacgacac ccccgacacc        60
     gcggacgacg gtgccaccga cagcggcgtg cccgtacttc gtgaccccgt tctcgtcgcc       120
     gccttcgagg gctggaacga cgccggcgac gccgcgagcg gagccgtcga gcacctcgaa       180
     ctgacgtggg acgcccagcc gctggccgag ctggactccg aggagtacta cgactaccag       240
     gtcaaccgcc ccacggtccg gcaggtcgac ggcgtcaccc gggagatcgt gtggccggcc       300
     acccgcctgt cggtgtgctc gcccccgggc agcgaccgcg acgtggtgct gctgcgcggt       360
     atcgaaccga acatgcgctg gcgcagcttc tgcgaggacc tcctcgagct gatcgatcaa       420
     ctgcagatca acaccgtggt gatcctcggg gcgctgctcg cggacacccc gcacacgcgg       480
     ccggtcccgg tgacgggcag cgcgtacagc agcgaggccg ccgaacggtt caagatcgag       540
     cagacccggt acgagggacc gacggggatc accggggtgc tgcaggacgc gtgcgtccgg       600
     gccggagtgc ccgccgtgtc gttctgggcg gccgtgcccc attacgtgtc ccagccgccg       660
     aaccccaagg cgacggtggc gttgctgcag cgcgtcgagg acgtcctgga catcgaggtg       720
     ccgctcgggg aactcccgtc gcaggccgac gactggcagg aagccgtcac cgagatgacc       780
     gcggacgacg aggaaatcgg cgactacgtc cgctccctcg aggagcgggg cgacgccgag       840
     accgacatct ccgaggccat ctcgaagatc gacggtgatg cgctcgcggc cgagttcgag       900
     cggtatctgc gcaggcgtgg gcccggcagc ttcgggctgt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page