(data stored in ACNUC7421 zone)

EMBL: AP011115.PE599

AP011115.PE599       Location/Qualifiers
FT   CDS_pept        617886..619037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05990"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48846"
FT                   /db_xref="GOA:C1ASR4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR4"
FT                   /protein_id="BAH48846.1"
FT                   /translation="MTRNSSESLRSSLQRTALYAGGFLGPFGGGVVASILPEIGDDLGV
FT                   SASAAAGSLTAYLLPFALLMLVSGTLGARWGQMRTVRIAYGVYLLSSLACFAAPTLPLF
FT                   LGARVLQGCSNSFTTPLLLAALAASTPKKHLGRALGIFGAFQAAGQSSAPLVGGLAAEV
FT                   DWRLAFLVIALVAAVLGLVGVPDSPPAEPGAARPRLRDALTPSVLRIGVVALLGWGALG
FT                   GLSFLVAFRAEDVFGLSPTQRGLLLTGFGVAGILTARLVGGVIDKFGARAAVLIGAFGG
FT                   AALVAAAGTVSLLPVVAVAWFAAGTAGQFILVGVNAAVLGSPGPNRGGAVSVVQALRFT
FT                   GNALAPITLTPVYAVSPAAGFLLPALLLAVLAPLLMPRDRPPA"
     gtgacgagga actcgtccga gtcgcttcgt tcctcgctcc agcgcacggc gctctacgcc        60
     ggcggtttcc tcggcccgtt cggcggcggg gtggtcgcct cgatccttcc cgagatcggt       120
     gacgacctcg gcgtgagcgc gtccgccgcg gcagggtcgc tgacggcgta cctgctgccg       180
     ttcgcgttgc tgatgctggt gtcgggcacc ctgggcgccc ggtgggggca gatgcggacc       240
     gtgcggatcg cgtacggcgt ctatctgctg tcgtcgctgg cctgcttcgc ggcgccgacg       300
     ctgccgctct tcctcggcgc gcgcgtgctt cagggatgtt ccaactcgtt cacgacgccg       360
     ctgctgctgg ccgcgctcgc cgcctcgacg ccgaagaagc acctcggccg ggcgctgggg       420
     atcttcggtg ccttccaggc cgcgggtcag tcgagcgcgc cgctcgtcgg cggcctcgcg       480
     gcggaggtcg actggcggct cgcgttcctc gtcatcgccc tcgtggccgc ggtgctcggt       540
     ctggtcggtg ttcccgacag cccgcccgcc gagccggggg cggcgcgccc gcgactgcgg       600
     gacgccctca ccccgtcggt gctgaggatc ggggtggtcg cgctcctcgg ctggggcgca       660
     ctcggtgggc tgagcttcct ggtcgcgttc cgcgccgagg acgtgttcgg cctgagcccc       720
     acccagcgcg gcctgctgct caccgggttc ggcgtcgccg gcatcctcac cgcacgcctc       780
     gtcggcggtg tcatcgacaa gttcggggcc cgagccgccg tgttgatcgg cgcgttcggc       840
     ggggcggctc tcgtcgccgc cgccgggaca gtctcgctcc tcccggtcgt ggcggtggcg       900
     tggttcgcgg ccggaaccgc aggtcagttc atcctggtcg gcgtcaacgc cgcggtgctc       960
     gggtcgccgg gcccgaaccg gggcggcgcg gtgtccgtcg tgcaggcgct gcggttcacc      1020
     ggcaacgcgc tcgcgccgat caccctcacc ccggtgtacg cggtctcgcc cgccgccggc      1080
     ttccttctgc cggccctgct cctcgccgtg ctggccccat tgctgatgcc ccgcgaccgg      1140
     ccacctgcct ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page