(data stored in ACNUC7421 zone)

EMBL: AP011115.PE60

AP011115.PE60        Location/Qualifiers
FT   CDS_pept        51675..51905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48307"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS58"
FT                   /protein_id="BAH48307.1"
FT                   /translation="MTGNTENVNRMMTFALHWFPHRGGPAAEIVAVLGMDTGEFFRCLN
FT                   AQLHPNPPTPLRPEIVQKMKAVARRRLWLAG"
     atgaccggaa acacggaaaa tgtgaatcgg atgatgacct tcgcgcttca ctggttcccg        60
     catcgcggcg gcccggcggc ggagatagtc gctgttctcg gtatggatac cggcgagttc       120
     ttccgctgcc tgaacgcgca gctgcacccg aaccctccaa ctccgctccg accggagatt       180
     gtgcagaaga tgaaggcagt ggcacggcgg cgtctgtggc tcgcaggttg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page