(data stored in ACNUC7421 zone)

EMBL: AP011115.PE603

AP011115.PE603       Location/Qualifiers
FT   CDS_pept        624340..624927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48850"
FT                   /db_xref="GOA:C1ASR8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR8"
FT                   /protein_id="BAH48850.1"
FT                   /translation="MTRIPQAELTGIYGAVVKRMSRKMLGDVPDGVGVVWHNRKVTNFS
FT                   FSLGRKIQKWDRCDENLKSFAHMAVASMVGCGFCLDYGYFQAHNKGLDETKAREVPRWR
FT                   ESDVFTPLERDVLEYAEAMTLTPPTVTDDLSARLLGALGPAALVELTAFIALTNFMTRS
FT                   NTAFGIESQGLAASCGLKPLSARPTTRTQPTS"
     atgaccagga tcccgcaggc cgagctgacc ggcatctacg gtgcggtcgt caagcggatg        60
     tcccgcaaga tgctcggcga cgttcccgac ggagtgggag tcgtgtggca caaccgcaag       120
     gtgacgaact tcagtttcag cctcggtcgc aagatacaga aatgggaccg gtgtgacgag       180
     aatctgaaat cgttcgcaca catggcggtc gcgagcatgg tcggctgcgg cttctgcctg       240
     gactacggct atttccaagc ccacaacaag ggactggacg agacgaaggc gcgcgaggtg       300
     ccgcggtggc gcgagtcgga cgtcttcacg ccgctggagc gggacgtcct ggagtacgcc       360
     gaggcgatga cgctgacgcc accgaccgtc accgacgacc tgtcggccag gctcctgggg       420
     gcactcggtc ccgccgcgct ggtggaactg accgcgttca tcgcactgac gaacttcatg       480
     acccgctcca acaccgcgtt cggcatcgag tcgcagggcc tcgccgcgtc gtgtggcctg       540
     aagccgctga gcgcacgccc gacgacccgc actcagccga cgtcgtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page