(data stored in ACNUC7421 zone)

EMBL: AP011115.PE604

AP011115.PE604       Location/Qualifiers
FT   CDS_pept        complement(624912..625352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48851"
FT                   /db_xref="InterPro:IPR021607"
FT                   /db_xref="InterPro:IPR023159"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR9"
FT                   /protein_id="BAH48851.1"
FT                   /translation="MGYLHTARSKFTIASWSESVITDIDGEGTTAGDTYYPARGATRAD
FT                   VEYSYSGDIEGTSTVAYLIAYKADAAPVLGLERFEGSIGGHDGTCVFQHLGSQDQGSVS
FT                   ARIEVVPGMGTGGLTDLRGSADLSIAGPGDGGFEFVLSYDVG"
     atgggctact tacacactgc tcgaagcaaa ttcaccatcg cgtcgtggtc ggaatcggtg        60
     atcaccgaca tcgacggcga aggtacgacg gccggcgaca cctactaccc cgcgcgcggc       120
     gccacccgcg cggacgtcga atactcgtac tccggggaca tcgaaggaac gagcacggtg       180
     gcctacctga tcgcgtacaa ggccgatgcc gcgccggtgc tcggcctcga gcgcttcgag       240
     ggctcgatcg gcgggcacga cggaacgtgc gtgttccagc acctcggcag ccaggaccag       300
     ggttccgtgt ctgcacggat cgaggtggtg ccgggtatgg gcacgggcgg tctgaccgac       360
     ctgcgcggca gcgcggacct gtccatcgcc ggacccggcg acggcggctt cgagttcgtc       420
     ctgtcctacg acgtcggctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page