(data stored in ACNUC7421 zone)

EMBL: AP011115.PE61

AP011115.PE61        Location/Qualifiers
FT   CDS_pept        complement(52161..52730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00610"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48308"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS59"
FT                   /protein_id="BAH48308.1"
FT                   /translation="MSAPFDITDTIIGSGARAGSGIRDDAHRLLRECRAKAALVTELSL
FT                   DGPLSAKTYAGVNLPAARRRRHPAASEPPWGRDEVEALPSGSALLVVTRGPNRGEWFLL
FT                   DQPVTTIGRHIDSDIYLDDTTVGRRHAQIRCDNDTFRVTDVGSLNGTYRNRAPVDTALL
FT                   ADGDEIKIGKFRLAFLITPPSAATDQ"
     gtgagcgcac cattcgacat caccgacacc atcatcggct ccggtgctcg ggccggttcg        60
     ggcattcgag atgacgctca ccgtctgctc cgcgagtgtc gagcgaaagc cgcactggtg       120
     accgagttgt cactcgatgg cccactgtcg gcgaagacgt acgccggggt gaatctcccc       180
     gccgcccgcc gtcgacggca tccggccgcc agcgaaccgc cgtggggccg tgacgaggtc       240
     gaggcactgc cgtctggttc ggcgctgctc gtggtcaccc gggggccgaa ccgcggtgag       300
     tggttcctgc tcgatcagcc ggtcaccacg atcggtcgcc acatcgacag cgacatctac       360
     ctcgacgaca cgaccgtcgg ccgtcgccac gcccagatcc ggtgcgacaa cgacacattt       420
     cgggtgaccg atgtcggcag tctcaatggc acctaccgca accgggcacc ggtcgacact       480
     gcactgctcg ccgacggtga cgagatcaaa atcggaaaat tccggctcgc gttcctcatc       540
     acaccgcctt cagcggcaac agatcaatga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page