(data stored in ACNUC7421 zone)

EMBL: AP011115.PE610

AP011115.PE610       Location/Qualifiers
FT   CDS_pept        629626..631167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48857"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS5"
FT                   /protein_id="BAH48857.1"
FT                   /translation="MSESGSDPGRSPSGLRAARPAVAPPLRDDRLKLFSFATAEKRAEY
FT                   LWVLRAFDHARANYIVLLHAGDVARILDGLAGDDPAGQLGAGDVTPLLEQLHVWEVLER
FT                   SYDGTRAATLAEYLNRHFVYQFSQAGYQVFRAVEDALAARLDDASLSRLALPDLLADMN
FT                   DLAAANRAADNDLVYRKLNRLDATLSDMAGRAAQFYLTLGDLVRTTEITPETFMSHKDA
FT                   LLTHMREFSSDLSRYAPKLAAAIALVEDSGVEAMVARAAASDERVFLDVEEREADWRSR
FT                   WAGVTHWFVGSEAGPSESERLREGTMSAIAAVLSLLRRVTETRKGGVSRESQLRHLAGW
FT                   FAATPNEDAAHALFRAVFDLGRPRHLSMVHPDADIIPDTRSWWEAQPVEISRTLAETGR
FT                   PPSPGLPARVQRNEGSVRRLREEQLTAQRLRAAAAQSLARGGVYERELDEAETDVLLSL
FT                   LNAALTARVPVSGRVKSSTGSENGVKLTLSPHGESTVVRTARGRLHLDGLQVSVR"
     gtgagtgaat caggcagcga tcccggtcgg tccccctcgg ggctgcgcgc cgcgcgccca        60
     gcggtcgctc ccccgctgcg ggacgaccgg ctgaaactgt tctccttcgc caccgcggag       120
     aaacgagcgg agtacctgtg ggtgctgcgg gcgttcgatc acgcccgcgc caactacatc       180
     gtcctgctcc acgcgggcga cgtcgcccgc atcctggacg gcctcgccgg cgacgacccg       240
     gccgggcaac tcggcgccgg agacgtcact cccctgctcg agcaactcca cgtctgggaa       300
     gtgctcgaac gcagttacga cggaacgcgc gccgcgacac tcgccgagta cctgaaccgg       360
     cacttcgtct atcagttcag tcaggccggc taccaggtgt tccgggccgt cgaggatgca       420
     ctcgcggctc gcctcgacga cgcgtcgctg tcccggctgg cactccccga cctcctcgcc       480
     gacatgaacg acctggccgc ggcgaatcgt gccgccgaca acgacctggt gtaccggaaa       540
     ctcaaccgac tcgatgcgac gctgtccgac atggccggac gcgccgccca gttctatctg       600
     accctgggcg acctcgtccg caccacggag atcaccccgg aaacgttcat gtcccacaag       660
     gacgctctgc tcacgcacat gcgcgagttc agctccgacc tgtctcgata tgccccgaaa       720
     ctcgccgcgg ccatcgcgct cgtggaggac tccggcgtcg aggcgatggt ggcgcgggcc       780
     gccgccagcg acgagcgggt gttcctcgat gtcgaagagc gcgaagctga ttggcgttcg       840
     cggtgggcgg gtgtgacgca ctggttcgtc gggagcgagg cgggcccgag cgagtcggaa       900
     cgcctgcgcg agggcacgat gagcgccatc gccgccgtcc tgtcgctgct gcgccgcgtc       960
     accgagaccc gcaagggcgg cgtcagcagg gagagtcaat tgcgccatct cgcgggctgg      1020
     ttcgccgcga ctccgaacga ggacgcggcg cacgcgctgt tccgggccgt gttcgacctc      1080
     ggccgtccgc gccacctctc gatggtgcat ccggacgccg acatcatccc cgacacccgg      1140
     tcgtggtggg aggctcagcc cgtcgagatc tcccgcaccc tggccgagac cggacgtccc      1200
     ccgtcccccg gtctgcccgc gcgggtgcag cgcaacgagg gcagcgtgcg ccgcctgcgt      1260
     gaggaacagc tgactgcaca acgacttcgc gcggccgccg cacagtcgct cgcccggggc      1320
     ggagtctacg aacgggaact cgacgaggcc gaaaccgacg tgctgctgag cctgctcaac      1380
     gccgcactga cggcgcgggt accggtcagc ggccgcgtca agagcagcac cggatcggag      1440
     aacggcgtga agctcaccct cagcccacac ggcgaatcga cggtggtgcg caccgcccgg      1500
     ggacgtctgc acctcgacgg actgcaggtg agcgttcggt ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page