(data stored in ACNUC7421 zone)

EMBL: AP011115.PE611

AP011115.PE611       Location/Qualifiers
FT   CDS_pept        631164..632552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48858"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS6"
FT                   /protein_id="BAH48858.1"
FT                   /translation="MKAREISPLALDSYQRAARVILSNHLVTQTYPDRIALPLLRRWAT
FT                   ELREDLMTLFGYRLEVTETTARLFTVSDRLDAGTPAKTATDRTFDRYRYAYLALALAAL
FT                   GRAGNQITLSELADHVAADAAQVEGVDLSTERASDRDAFVDAVGWLAARGAIALADGDA
FT                   GGWAANPDAGEALYDIDRSVVIALFRPPRALQHLRSIRGLLAGADSVTDEDTAETSRTV
FT                   DVKETTRRVRRALVERPVVYAADLDDHELVQLALPRTAADVELLTGLVAERREEGVAMI
FT                   DSSGRLSDVRFPGTGTVAQVALLLAGEIADRVLDPDAAETARMPLPRGRSEDLVEQVDG
FT                   AIPQSGIFDSLAGHDGVEPAEPAPADRLFPVVEDQWITDTVRTLTERFGRTFAAGWQAD
FT                   PDGLGRAALALLERLRLTASVPGGVLALPALARYRGVVVTIRDRTPEIDLFQSSANDSE
FT                   DITA"
     gtgaaggcac gggagatctc accgctcgcc ctcgattcgt atcagcgcgc cgcccgcgtc        60
     atcctgtcga atcatctcgt gacacaaacc tatccagatc ggatcgcgct tcccctgctc       120
     cgccggtggg ccaccgaact gcgcgaagat ctgatgacgc tcttcgggta ccggctcgag       180
     gtcaccgaga cgaccgcccg actgttcacg gtgagcgacc gactcgacgc cgggacaccg       240
     gccaagacgg ccaccgaccg cacgttcgac cggtaccgtt acgcctacct cgcgctggcg       300
     ctggcggccc tcggtcgcgc cgggaaccag atcaccctgt ccgaactcgc cgatcacgtc       360
     gccgccgacg ccgcgcaggt cgaaggggtg gacctgtcca cggagcgcgc gtccgaccgg       420
     gacgcgttcg tcgacgccgt cggctggctc gccgcgcgcg gcgcgatcgc actcgccgac       480
     ggtgacgcgg gcggctgggc cgccaatccc gatgcgggcg aagcgctcta cgacatcgac       540
     cggtccgtcg tcatcgccct gttccggccg ccacgcgcac tgcagcatct ccgctccatc       600
     cgcggtctgc tcgccggcgc ggactcggtg accgacgagg acaccgcgga gacctcccgg       660
     acggtcgacg tgaaggagac gacgcggcgg gtccggcgcg cgctcgtcga acggcccgtc       720
     gtctacgccg ccgacctgga cgatcacgaa ctggtgcaac tcgcgcttcc ccgcaccgcg       780
     gcagatgtcg agttgctcac cggactggtc gccgagcgtc gcgaggaggg cgtcgcgatg       840
     atcgactcgt ccgggcggct ctccgacgtc cggttccccg ggacggggac ggtcgcgcag       900
     gtcgcgctcc tgctcgccgg ggagatcgcc gatcgggtcc tggatcccga cgccgcggag       960
     acggcccgga tgccgctgcc gcggggccgg tccgaagacc tggtcgaaca ggtggacggc      1020
     gcgattccgc agtccgggat cttcgacagc ctggcaggcc acgacggagt cgaacccgcg      1080
     gaacccgccc ccgccgaccg gctcttcccg gtcgtcgagg accagtggat caccgacacc      1140
     gtccggaccc tgaccgagag attcgggcgc acgttcgccg ccgggtggca ggccgacccc      1200
     gacggcctgg gacgcgccgc gctggcgctg ctcgagcggc tgcgtctcac cgcgtcggtg      1260
     ccgggcggcg tgctcgcgct cccggcgctc gcccgctacc ggggtgtggt ggtcacgatc      1320
     cgcgaccgca caccggagat cgacctgttc cagagctcag cgaacgacag cgaggacatc      1380
     acagcatga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page