(data stored in ACNUC7421 zone)

EMBL: AP011115.PE612

AP011115.PE612       Location/Qualifiers
FT   CDS_pept        632549..636706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48859"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS7"
FT                   /protein_id="BAH48859.1"
FT                   /translation="MTSARFRPTRAGIINLWDYRDQEFSFADGRLVLRGPNGSGKTKAL
FT                   EVLFPFVFDGRIEPRRLNPFAGEERTMKSNLLYRGQESAYSYVWMEFCRGAKDDPEAVT
FT                   VGIGMRASRTNDKVTRWYFVADGRVGVDFSLLGTDDRPLTKKQLGEQIGTDSITDRPLD
FT                   YRAAIDARMFGLGVQRYDQLINLILTLRRPQLAKNLDPKGLSQALTDGLRPLDEQLVLE
FT                   AARSFSDMEEVGRALEGLAAADQAAQSFVGVYAKYLRQQARTDVDQLATRLDAVRSGIT
FT                   ALHGAAADRARSQESREAAEERFTVAERALDQANATLDALKRSTAYEGRTQLDDLAQAV
FT                   STLEKSTALQAEKARKAKATLEQRSEEHEKAGDAVTRAVEALAHAEDELHVAAEDAGIT
FT                   WTALPDTARADQLTAALRGHAEERDGDLRAVRAALATVERAATERTRADDAARRGQEQL
FT                   DTAKVAVLEAETAVESARSRCATELRSWWTEQSSLYAEIEAPAALFDALDTALRGIGDE
FT                   DAATLSETLTEQTRDAVDALRMRRQQYDRDAAAAAEAIAEYESVRAAIESEHDDAPPLP
FT                   AGRHDTRSGLTGAPLWRLVRFADGVDAAVAAGIEAALEAANLLDGWVPVDDALPDVESE
FT                   QFLVALPAGDRPTGRTLADVLEVEQDTGVPDDRVRGILESIALESLDPAEGPVGVAQDG
FT                   GYRQGIQRGRHTKSDAEYIGTTARARRRAARLVELDRTLAETRATLDDTRASAEAVAEL
FT                   LTRTTAAARALPRTGSILTALKKVTESAGALRSRTDTATAVGRELDQAIADLSAKEKQL
FT                   RATASTHRTPHVAREIDSLAAAVRHFEKQGEMVQRCRREHGKEVEHTRQSEDRLHEARG
FT                   NAEEYAEEAAVAEEVLAQQIQRLGTLRDTLGAGAEELDRQLEEAHARIEACKKEQRDAR
FT                   KADKDAGEAIGKAEGAYNTAVQTLRLALTETHADAAHLAPYARRDLLELLGVDGGHTWP
FT                   ASAAAWMSAEQLVYRIQNAGQDIPILPPEVDALFRALDSATDSVRVSDSARKSTRTALT
FT                   TALQDFDAQLAAAGQDYRLQWDAPDGLTVVQVQDDEGYSSIGEFAARIASARSDQELLL
FT                   TESERRILEDALLTGLAQQIHERTVDARELIARMGTEMRERRMSSGNTIGVHWVLADNL
FT                   DDSAKAISKLLERDTSALGPDELATMRAHFAHQIRTARAAHPERSYPEILASALDYRRW
FT                   RVFSFTLISGNGTEDRLTVARHSALSGGEQSVSLHLPLFAAAHVMLDSADPHAPRLLAL
FT                   DEAFAGVDDNGRAELLGLSVQFDLDLFMTGFDLWITYGGVPGCAHYDLAHSTAEQSVSA
FT                   TLLVWSDGELLAEHDGTDLAQALGSPLRRRVPTPAEGALEFA"
     atgacgagtg cgcgtttccg gcccacccgc gccgggatca tcaacctctg ggactaccgg        60
     gatcaggagt tctccttcgc cgacggccgc ctcgttctcc gtggccccaa cggttccggc       120
     aagaccaagg cgctcgaagt gctgttcccg ttcgtcttcg acggcaggat cgaaccgcgg       180
     cgcctcaacc cgttcgcggg cgaggaacga accatgaagt cgaacctcct gtatcgcggg       240
     caggagagcg cgtactcgta cgtctggatg gagttctgcc gcggcgcgaa ggacgacccc       300
     gaagccgtca ccgtgggaat cggcatgcgc gcctcccgca ccaacgacaa ggtcacgcgc       360
     tggtacttcg tggccgacgg cagggtcggc gtcgacttct ccctgctcgg cacggacgac       420
     cggccgctca cgaagaagca actcggcgaa cagatcggca ccgactccat caccgaccgt       480
     ccgctcgact accgcgccgc catcgacgcc cgcatgttcg ggctcggtgt ccagcgctac       540
     gaccagctga tcaacctcat cctcacgctg cgccgcccgc agctcgcgaa gaacctcgat       600
     cccaagggac tgtcgcaggc actcaccgac ggtctgcgtc ccctcgacga acaactggtc       660
     ctcgaggcgg cgcgctcgtt cagcgacatg gaggaggtcg gccgggcact cgaagggctg       720
     gcggcggcgg accaggcggc gcagagcttc gtcggcgtgt acgcgaaata ccttcgccag       780
     caggcgcgta cggacgtcga ccaacttgcg acccggctcg acgcggtgcg gtccggcatc       840
     accgccctcc acggggcggc agccgaccgg gcacgcagtc aggagagccg ggaggccgcc       900
     gaagaacgct tcaccgtcgc cgaacgcgca ctcgaccagg ccaacgccac cctcgacgca       960
     ctgaagcggt cgaccgccta cgaggggcgg acgcagctcg acgacctggc gcaggccgtg      1020
     tcgacgctcg agaagtcgac ggcgctgcag gcagagaagg cacgcaaggc caaggcgacc      1080
     ctcgaacagc ggtccgagga gcacgagaag gccggtgacg ccgtcacccg cgccgtcgag      1140
     gcgctcgccc acgccgagga cgaacttcac gtcgccgccg aggacgccgg aatcacctgg      1200
     accgcactcc ccgacaccgc gcgcgccgac cagttgaccg cggcgctgcg cgggcacgcc      1260
     gaggaacgcg acggcgacct tcgcgcggtc cgggccgcgc tcgccaccgt cgagagggcc      1320
     gccaccgagc ggacccgcgc cgacgacgcg gcgcgtcgcg gtcaggagca actcgacacc      1380
     gcgaaggtgg ccgtcctcga ggccgagacc gcggtcgaat cggcccgcag ccggtgcgcc      1440
     accgaactcc gctcctggtg gacggaacag tcgtccctct acgccgagat cgaggcgccc      1500
     gctgcgctgt tcgacgcact ggacaccgcc ctccgcggga tcggcgacga ggacgccgcc      1560
     actctgtcgg agacgctgac ggagcagacc agggacgccg tcgacgcact ccggatgcgt      1620
     cgtcagcagt acgaccggga cgccgccgcc gcggccgagg cgatcgccga atacgaatct      1680
     gtgcgcgcgg caatcgaatc cgagcacgac gacgccccac ccctcccggc cggcaggcac      1740
     gacacgcggt ccgggctgac cggtgcgccg ctgtggcgtc tggtccggtt cgccgacggt      1800
     gtcgacgccg cggtcgcggc gggaatcgaa gccgcactgg aggccgcgaa cctcctcgac      1860
     ggctgggttc ccgtcgacga cgcgcttccc gacgtcgaat ccgaacagtt cctcgtggcc      1920
     ctcccggccg gggaccggcc caccggcagg accctcgccg acgttctcga agtcgaacag      1980
     gacacgggtg ttcccgacga ccgcgtgcgc ggcatcctcg aatccatcgc cctcgaatcc      2040
     ctcgaccccg ccgagggacc ggtgggcgtt gcccaggacg gcgggtaccg ccaggggatc      2100
     cagcggggac gacacacgaa atcggatgcg gagtacatcg gaaccaccgc gcgggcccgc      2160
     aggcgcgccg cccgactcgt cgaactcgac agaacgctcg cggaaacccg ggcgacgctc      2220
     gacgacaccc gggcgtccgc ggaggcggtg gcagagctgc tgacgcggac caccgcggcg      2280
     gcgcgggccc tcccccgcac cggatcgatc ctcaccgcgc tgaagaaggt caccgaatcg      2340
     gcaggcgcgc tccgcagccg taccgacacc gcgacagctg tcggtcgcga actcgaccag      2400
     gccatcgccg acctgtccgc gaaggaaaag caactccgag ccaccgcatc cacgcaccgg      2460
     acaccccacg tcgcccgcga gatcgactcg ctcgccgcgg ccgtgcggca tttcgagaag      2520
     cagggcgaga tggtgcagcg gtgcaggcgc gaacacggca aggaagtgga gcacacacga      2580
     cagtccgagg accggctgca cgaggcgcgc ggcaacgcgg aggaatacgc ggaggaggcc      2640
     gccgtcgccg aagaggtcct cgcgcaacag atccagcgcc tcgggacact ccgcgacacg      2700
     ctgggcgcgg gggccgagga actggaccgg caactcgagg aggcgcacgc gcggatcgag      2760
     gcgtgcaaga aggagcagcg cgacgcccga aaggcagaca aggatgcggg cgaggccatc      2820
     ggcaaagccg agggcgccta caacaccgcc gtccagacgc tacggctggc cctcaccgaa      2880
     acccacgccg acgccgccca cctcgcgccg tacgcccggc gcgacctgct cgaactcctc      2940
     ggcgtcgacg gaggccacac ctggcccgcc agcgcggcgg cgtggatgag tgccgagcag      3000
     ctggtgtacc gcatacagaa cgccggtcag gacatcccga tcctgccgcc cgaagtggac      3060
     gcgctgttcc gcgcactgga cagcgccacc gactcggtgc gggtcagcga ctcggcacgc      3120
     aagtcgacgc ggaccgcgct caccaccgcg ctgcaggatt tcgacgcaca actcgccgcc      3180
     gccggccagg actaccggct gcagtgggac gcacccgacg gcctgacggt ggtgcaggtg      3240
     caggacgacg agggttactc gtcgatcggc gagttcgccg cccgcatcgc gtccgcgcgc      3300
     tccgaccagg aactgctgct caccgaatcc gaacgtcgca tcctcgagga cgcgctgctc      3360
     acgggtctcg ctcagcagat tcacgaacgg accgtcgacg cccgcgaact catcgcccgg      3420
     atgggcaccg agatgcggga gcggcggatg tcgtcgggca acaccatcgg cgtccactgg      3480
     gtcctcgccg acaacctcga cgacagcgcg aaggccatct ccaaactgct cgagcgcgac      3540
     acctcggcgc tgggcccgga cgagctcgcc accatgcgcg cccacttcgc ccaccagatc      3600
     aggactgccc gcgccgccca cccggagcgg tcgtacccgg agatcctggc gtccgccctc      3660
     gactaccggc ggtggcgggt gttctcgttc accctgatca gcggcaacgg caccgaggac      3720
     aggctgacgg tcgcccggca cagcgcactc tccggcggcg agcagtccgt ctcgctgcat      3780
     ctgccgctgt tcgccgcggc gcacgtgatg ctcgactcgg ccgacccgca cgccccgcgg      3840
     ctgctggcgc tggacgaggc gttcgccggc gtcgacgaca acggccgggc ggaactgctc      3900
     ggcctcagcg tgcaattcga cctcgacctg ttcatgaccg ggttcgacct gtggatcacc      3960
     tacggcggcg tgccgggctg cgcacactac gatctggcgc actcgacggc ggagcagagc      4020
     gtcagcgcca ccctcctcgt gtggtccgac ggtgaactac tcgccgaaca cgacggcacc      4080
     gacctggcgc aggcgctcgg ttcgcccctc cgccggcgcg tcccgactcc cgcggagggt      4140
     gccctcgagt tcgcctga                                                    4158
//

If you have problems or comments...

PBIL Back to PBIL home page