(data stored in ACNUC7421 zone)

EMBL: AP011115.PE615

AP011115.PE615       Location/Qualifiers
FT   CDS_pept        complement(638873..639466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48862"
FT                   /db_xref="InterPro:IPR021441"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST0"
FT                   /protein_id="BAH48862.1"
FT                   /translation="MSRAIHVFRTPDRFIAGTVGEPGDRSFYLQAVHEARVISVLLEKQ
FT                   QVQVLADRMGLLLEEVHRRFGTDVPPEGAELDDSSPLVTPIDAEFRVGTMGLGWDADAG
FT                   AVVVELLAVSETEFDESVVLDDSEDGPDAVRVFLTPLQARDFSLRSERVIAAGRAPCPL
FT                   CGEPLAPEGHICIRTNGYRRGQSFGLTPEMDEED"
     atgtcacgcg caattcacgt attccgcact cctgaccgat tcattgccgg gacggtgggt        60
     gaacccggcg acaggtcgtt ctatctccag gccgtacacg aggcgcgagt gatcagcgtc       120
     ctgctcgaga aacagcaggt tcaagtactg gccgaccgga tgggtcttct cctcgaggaa       180
     gtccaccgca gattcgggac ggacgttccc ccggaagggg ccgaactgga cgactccagc       240
     ccactcgtca ccccgatcga cgccgagttc cgggtcggga cgatgggcct gggctgggac       300
     gcggacgccg gagccgtcgt ggtggaactg ctcgccgtca gcgagacgga attcgacgag       360
     tccgtcgtcc tcgacgactc cgaggacggg ccggacgccg tgcgcgtctt cctcaccccg       420
     ctgcaggcga gggacttctc gttgcggtcc gaacgggtca tcgccgccgg tcgcgcgccg       480
     tgcccgctgt gcggtgagcc gctcgccccg gagggacaca tctgcatccg caccaacggg       540
     taccgccgcg gccagagctt cggactcacc ccggaaatgg acgaggagga ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page