(data stored in ACNUC7421 zone)

EMBL: AP011115.PE623

AP011115.PE623       Location/Qualifiers
FT   CDS_pept        complement(646115..646510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48870"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST8"
FT                   /protein_id="BAH48870.1"
FT                   /translation="MVSRPPAQVIEEQTVEAPETPTFTVEDISVGPHAHGFGRTAEGNS
FT                   YAFRVRKSTMHVEVYRADVETEVPDPDDVVASARRSVREIDLTDERSIVAVVRDAVSDP
FT                   DSLSARPEDGITVRAVLSRLGAVIDGL"
     gtggtttccc gaccgccggc ccaggtcatc gaggagcaga ccgtggaagc acccgaaacg        60
     ccgacgttca ccgtcgaaga catctcggtc ggtccgcacg cgcacggctt cggccggacc       120
     gccgaaggca actcctacgc attccgcgtg cgcaagagca cgatgcacgt cgaggtgtac       180
     cgcgccgacg tcgaaaccga ggtcccggac ccggacgacg tcgtggcctc cgcgcggcgc       240
     tcggtccggg agatcgacct gaccgacgag cgcagcatcg tcgccgtcgt gcgcgacgcc       300
     gtgtccgatc ccgattccct gtcggcacgg ccggaggacg gcatcaccgt gcgggcggtc       360
     ctcagccgtc tcggggcggt catcgacgga ctgtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page