(data stored in ACNUC7421 zone)

EMBL: AP011115.PE624

AP011115.PE624       Location/Qualifiers
FT   CDS_pept        646653..647663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48871"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST9"
FT                   /protein_id="BAH48871.1"
FT                   /translation="MGRPGARVVASCIGAAFLLVTGCSSNSDEDQAITIAPASAAQSPA
FT                   QSTAPAGVVHPVGLPIDSTTFDPETRTTVVLGGEGNQILLFPVGDFTAAPRTIPLDGAV
FT                   AQVSLAPGGVALLAMNTQVGRLDLRTGEVTFVPADGDVRSVAQLPDGRLAMGLGNGEIH
FT                   IVNTETNESQVIDGLTSVDGLAVVGDSLTALDRGQTSVTAVDVPGSALGVALRAGEGAT
FT                   QLTTDHYGRILVTDTTGDELLAYTTDTLMLRQRFPAGLAPYAVAYDDTADRAWVTLTGT
FT                   NEVVGFDLSSGVGVETARYPTVRQPNSVTVDTVNGDLLIGSATGDGLQQIPTRSS"
     atgggtagac cgggagcgcg cgtcgtcgcc tcgtgtatcg gagcggcatt tctgctggtc        60
     acgggttgtt cgtcgaactc cgacgaagat caggcgatca cgatcgcacc cgcgagtgcc       120
     gcgcagtccc cggcgcagag caccgcgccc gcgggtgtcg tccaccccgt cggcctgccg       180
     atcgattcga ccacattcga ccccgagacc cgcacgaccg tcgtcctcgg cggcgaaggc       240
     aaccagatcc tgctgttccc ggtcggcgat ttcacggcgg ctccgcgcac gattccgctg       300
     gacggggccg tcgcccaagt ctccctggcc cccgggggcg tggcccttct cgcgatgaac       360
     acgcaggtag ggcggctcga cctgcgcacg ggtgaggtga cgttcgtccc cgccgacggc       420
     gatgtccgtt cggtcgcgca gttgcccgac ggtcggctgg cgatgggcct cggcaatggc       480
     gagattcaca tcgtgaacac cgagacgaac gagtcacagg tgatcgacgg cctcacctcc       540
     gtcgacgggc tggccgtcgt cggagactcg ctcaccgccc tcgaccgcgg tcagacgtcc       600
     gtcaccgccg tcgacgtccc cggctccgcg ctcggcgtcg cgctgcgcgc cggtgaaggc       660
     gcgacgcaac tcaccaccga ccactacggg cggatcctcg tcaccgacac caccggcgac       720
     gaactgctcg cctacaccac cgacacgctg atgctccgcc agcggttccc ggccggactc       780
     gcgccgtacg ccgtcgccta cgacgacacc gccgaccggg cgtgggtcac gctgaccgga       840
     accaacgagg tggtcggatt cgacctgtcc agcggtgtcg gcgtggaaac ggcccggtat       900
     cccaccgtcc ggcagccgaa ctctgtcact gtggataccg tgaacggtga cctcctgatc       960
     ggttccgcga cgggagacgg tttgcagcag atcccgacga ggagttcgta g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page