(data stored in ACNUC7421 zone)

EMBL: AP011115.PE625

AP011115.PE625       Location/Qualifiers
FT   CDS_pept        647664..647903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48872"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU0"
FT                   /protein_id="BAH48872.1"
FT                   /translation="MASHSRRLPSGWEIESEDYEYVPLRLPPDVTRVSASMRLALQAEF
FT                   GGWELSRVRLYSDGSRRVLLKRKKTAHHVPDPAI"
     atggcatcgc attcacgtcg actcccctcc gggtgggaga tcgaatccga ggactacgag        60
     tacgtgccgc ttcggctgcc acccgacgtc acccgggtca gcgcttcgat gcgcttggcc       120
     ctccaggcgg aattcggcgg ctgggagttg tcgcgggttc gcctgtactc cgacggaagc       180
     cgccgagtgc tgctcaaacg aaagaagacc gctcaccatg tccccgaccc cgcaatctag       240
//

If you have problems or comments...

PBIL Back to PBIL home page