(data stored in ACNUC7421 zone)

EMBL: AP011115.PE627

AP011115.PE627       Location/Qualifiers
FT   CDS_pept        complement(649055..649585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48874"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU2"
FT                   /protein_id="BAH48874.1"
FT                   /translation="MSHDPYEALPDLPSFELTSTDVTDGQPLNKEQVSGIFGAGGHDNS
FT                   PQLSWSGFPAETKSFAVTVYDPDAPTASGFWHWAVANIPADTTTLVSGAGDDDGTGLPS
FT                   GAITLKNDAGLSRFLGAAPPAGHGPHRYIIVVHAVDVEILDGVTADSTPAFLGFNLFSH
FT                   AIARAKIQGTYEQ"
     atgtcacacg acccgtacga ggcccttccc gacctgccga gtttcgagct gacctccacc        60
     gacgtcaccg acgggcagcc gctgaacaag gaacaggtca gcggaatctt cggcgcaggc       120
     ggccacgaca actcaccgca gctgtcgtgg tcggggttcc ccgccgagac caagagcttc       180
     gcggtgacgg tgtacgaccc cgacgcgccg acggcgtccg ggttctggca ctgggcggtc       240
     gccaacattc cggccgacac gaccacgctg gtcagtggcg cgggcgacga cgacggaacc       300
     gggctcccga gcggtgcgat cacgctgaag aacgacgcag gtctgagccg cttcctcggc       360
     gctgcgccgc cggcaggcca cggcccgcac cgctacatca tcgtggtcca cgcggtcgac       420
     gtggagatcc tcgacggcgt cacggccgac tcgacgccgg cgttcctggg gttcaacctg       480
     ttctcccacg cgatcgcccg cgcgaagatc caggggacgt acgagcagta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page