(data stored in ACNUC7421 zone)

EMBL: AP011115.PE628

AP011115.PE628       Location/Qualifiers
FT   CDS_pept        complement(649620..650972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06280"
FT                   /product="peptidase M20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48875"
FT                   /db_xref="GOA:C1ASU3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU3"
FT                   /protein_id="BAH48875.1"
FT                   /translation="MPTTQETPGQGRAEAEVVDLVSSLIRFDTSNTGELATTKGERECA
FT                   EWVASQLQEVGYETEYVESGAPGRGNVFARLKGSDPDRGALLLHGHLDVVPAEPADWRV
FT                   HPFSGAVEDGYVWGRGAVDMKDMVGMILAVARQFKAEGVVPPRDLVFAFVADEEAGGKY
FT                   GCQWLVENRPDLFEGVTEAVGEVGGFSLTVARPDGTDRRLYLVETAEKGLGWMRLTAKG
FT                   RAGHGSFLHGENAVTILAQAVARLGAHTFPLVMSDSVAEFLAAAGEETGLDFDPESPDL
FT                   DGTLAKLGTIANILGATLRDTANPTMLSAGYKANVIPQTAEAVVDCRILPGRQAEFEAT
FT                   VDELIGPDVTREWITKLDSYETTFDGHLVDAMNDAILAHDPGARTVPYMLSGGTDAKAF
FT                   AKLGIRCFGFAPLQLPADLDFSALFHGVDERVPVDALLFGTRVLEHFLLHS"
     gtgccaacta cacaggaaac cccaggccag ggtcgcgccg aagccgaagt cgtggatctc        60
     gtcagttcgc tgatccgctt cgacacgtcc aacaccggag agctcgcgac gacgaagggc       120
     gagcgcgagt gtgcggagtg ggtggcgtcc cagctgcagg aggtgggcta cgagaccgaa       180
     tacgtcgagt cgggtgcacc gggtcgcggc aacgtgttcg cacggctgaa gggctcggac       240
     cccgaccgcg gcgcactgtt gctgcacggt cacctcgacg tcgtccccgc agaaccggcc       300
     gattggcgcg tccacccgtt ctccggcgct gtcgaggacg gttacgtgtg gggccgcggc       360
     gccgtcgaca tgaaggacat ggtcgggatg atcctggcgg ttgcccgcca gttcaaggcg       420
     gagggcgtcg ttcctccccg cgacctcgtg ttcgcgttcg tcgccgacga ggaggccggt       480
     ggcaaatacg gctgccagtg gctggtcgag aatcgtcccg acctgttcga gggcgtcacg       540
     gaagcggtcg gcgaggtcgg tggtttctcc ctgaccgttg cccgcccgga cggcacggac       600
     cgcaggctct atctcgtcga gacggcggag aaggggctcg gatggatgcg gctcaccgcg       660
     aaggggcggg ccggacacgg ttcgttcctg cacggcgaga acgccgtcac catcctggcg       720
     caggccgtcg cccggctggg ggcgcacacg ttcccgttgg tcatgtccga ttcggtggca       780
     gagttcctcg cggcggccgg ggaggagacc ggactcgact tcgacccgga gtcgccggac       840
     ctcgacggca ccctcgcgaa gctcggcacc atcgccaaca tcctcggtgc cacgctccgg       900
     gacacggcca acccgaccat gctgtcggcc ggttacaagg ccaacgtcat cccgcagacc       960
     gcggaggccg tcgtcgactg ccggatcctg cccggtaggc aggccgagtt cgaggcgacg      1020
     gtcgacgaac tcatcgggcc ggacgtcacg cgcgagtgga tcaccaagct cgactcctac      1080
     gagacgacgt tcgacggaca cctcgtcgac gcgatgaacg acgccatcct cgcgcacgac      1140
     cccggcgccc ggaccgtgcc gtacatgctg tcgggcggaa ccgacgccaa ggcgttcgcg      1200
     aagctcggca tccggtgctt cggattcgca ccgctgcaat tgcccgccga cctggatttc      1260
     agcgcgctgt tccacggcgt cgacgaacgg gtacccgtgg acgcactact gttcggtaca      1320
     cgcgtgctgg aacattttct gctccacagc tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page