(data stored in ACNUC7421 zone)

EMBL: AP011115.PE629

AP011115.PE629       Location/Qualifiers
FT   CDS_pept        651243..652697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48876"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU4"
FT                   /protein_id="BAH48876.1"
FT                   /translation="MGETTTTIDPADLEICLKVLDLAAELDDADPDSVTVQRAVGHLFK
FT                   KLKKRRRIAARDAVSEADRKVVAATATGSPDRIDDETAGIPLTSNADGASAGTLIRPRP
FT                   CYICKQRYTRVDAFYHQLCPECATKSRAKRDARADLTGRRALLTGGRAKIGMYIALRLL
FT                   RDGAHTTITTRFPNDAIRRFKAMEDSSEWIHRLRVVGIDLRDPAQVVALADSVAAQGPL
FT                   DILINNAAQTVRRSPGAYSALADAESGALPSGDLPDVLTFGKTSDAHPAALAGSLSDVS
FT                   VMAGAALSPDAVSSLALVAKSASPDRIDQGLAIDAGGLLPDLAHTNSWVQTVEEVDPIE
FT                   LLEVQLCNSVAPFILVSRLRPAMAAAGARRKYVVNVSAMEGQFSRAYKGPGHPHTNMAK
FT                   AALNMLTRTSAKEMLEDGILMTAVDTGWITDERPHYTKMRLADEGFHAPLDLVDGAARV
FT                   YDPIVQGEQGVDLHGCFLKDYEPSPW"
     atgggtgaaa caacgacgac gatcgatccg gcggatctcg agatctgcct gaaagttctc        60
     gatctggcgg cggaactcga cgacgcggat cccgattccg tcacggtcca gcgtgctgtc       120
     ggtcaccttt tcaagaagct gaagaagcgc aggcggatcg cggcccgcga cgccgtctcc       180
     gaggccgacc gcaaggtcgt cgccgccacc gcgacgggct cccccgaccg gatcgacgac       240
     gagaccgcgg gcatcccgct gacgtcgaac gccgacggcg cgtccgcggg caccctgatc       300
     cggccccgcc cctgctacat ctgcaagcag cgctacacga gggtcgatgc gttctaccac       360
     cagctgtgcc ccgagtgcgc gacgaagagc cgcgccaaga gggatgcgcg cgccgacctc       420
     accggacgcc gggcgctgct gaccggtggt cgcgccaaga tcgggatgta catcgcgctg       480
     cgattgctcc gcgacggcgc ccacaccacc atcacgacgc gcttcccgaa cgacgccatc       540
     cgccgcttca aggcgatgga ggacagcagc gagtggatcc accggcttcg ggtggtcggt       600
     atcgatctgc gcgacccggc gcaggtcgtc gcgctcgccg actcggtcgc cgcgcagggc       660
     ccgctggaca tcctgatcaa caatgccgcg cagacggtgc gccgctcacc cggtgcgtac       720
     agcgcgctgg cggacgccga gtccggtgcg cttccgtccg gcgaccttcc cgacgtcctg       780
     acgttcggca agaccagcga cgcccacccg gcggcgctcg ccggatcgct gtccgacgtg       840
     tccgtgatgg cgggcgctgc gctgtccccc gacgcggtga gttcgctcgc actggtcgcg       900
     aagtcggcgt ctccggaccg gatcgaccag ggtctcgcga tcgacgccgg cggtctgctg       960
     cccgatctgg cgcacacgaa cagctgggtc caaacggtcg aggaagtcga cccgatcgag      1020
     ctgctcgagg tccagttgtg caattcggtc gccccgttca tcctcgtgtc ccggctgcgg      1080
     cccgcgatgg cggcggcagg tgcccgacgc aagtacgtgg tgaacgtctc tgcgatggaa      1140
     ggccagttca gccgcgccta caagggtcca gggcatccgc acaccaacat ggcgaaggca      1200
     gcgctgaaca tgctcacccg caccagcgcg aaggagatgc tcgaggacgg cattctcatg      1260
     accgcggtgg acacgggatg gatcaccgac gagcggccgc actacacgaa gatgcgtctg      1320
     gcagacgagg gtttccatgc ccccctcgat ctcgtcgacg gcgccgcccg cgtctacgac      1380
     cccatcgtcc agggcgagca gggcgtcgat ctgcacggct gcttcctgaa ggactacgag      1440
     ccctcaccct ggtga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page