(data stored in ACNUC7421 zone)

EMBL: AP011115.PE630

AP011115.PE630       Location/Qualifiers
FT   CDS_pept        652875..653219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06300"
FT                   /product="putative Usp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48877"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU5"
FT                   /protein_id="BAH48877.1"
FT                   /translation="MQRREQLLVLHVLDDDPGQDAESDRSALRAEIQATLEGGGVGESS
FT                   WELRTGEHDGDQVSALRALVDNSGADLLVVGTRRMSPVGKFLLERWLQRLLLEVDIPIL
FT                   VVKEEARGSA"
     gtgcaacgac gggaacagct actcgtcctc cacgtgctcg acgacgaccc cgggcaggat        60
     gccgagtccg accggtccgc gctgcgcgcc gagatccagg cgacgctcga aggtggcggg       120
     gtcggcgagt cttcgtggga actgcgcacc ggcgaacacg acggcgatca ggtgagcgca       180
     ctgcgcgcgc tggtcgacaa cagcggggcg gacctgctcg tcgtgggcac ccggcgcatg       240
     tccccggtcg gcaaattcct cctggaacga tggctgcagc gtctcctgct cgaggtcgac       300
     attccgatcc tggtggtcaa ggaagaggcg cgcggctcgg cctga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page