(data stored in ACNUC7421 zone)

EMBL: AP011115.PE631

AP011115.PE631       Location/Qualifiers
FT   CDS_pept        653307..653717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06310"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48878"
FT                   /db_xref="GOA:C1ASU6"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU6"
FT                   /protein_id="BAH48878.1"
FT                   /translation="MGSVVFYEVVADATVVAHLTFILYVVCGGFLAWRWPRTIVVHLAA
FT                   VAWGFTGLIVGIDCPLTHLESWARVRAGQDPLPSSGFISHYLTGVVYPESAAGAIQTLV
FT                   ALCVVTSWAGYVVLRTRTRTPLAPTRPGGAEL"
     atggggagtg tggtcttcta cgaggtcgtc gcggacgcga cggtcgtcgc gcacctgacc        60
     ttcatcctct acgtcgtgtg cggcggtttt ctcgcctggc ggtggccgcg caccatcgtc       120
     gtccacctgg ccgcggtcgc ctggggattc accggcctga tcgtcggcat cgactgcccg       180
     ctcacgcatc tggagagctg ggcccgcgtc cgcgccgggc aggacccgct cccctcctcc       240
     gggttcatct cccactacct caccggcgtg gtctacccgg aatccgccgc gggagcgatc       300
     caaaccctcg tggcactgtg cgtggtcacc tcgtgggccg gctacgtcgt cctgcggacc       360
     cgcacccgta cacccctcgc accgacccgc cccggcggtg ccgaactctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page