(data stored in ACNUC7421 zone)

EMBL: AP011115.PE632

AP011115.PE632       Location/Qualifiers
FT   CDS_pept        653753..654997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48879"
FT                   /db_xref="GOA:C1ASU7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU7"
FT                   /protein_id="BAH48879.1"
FT                   /translation="MTDSARELDLVVYGATGFVGKLLADYLAQHAPDGVRIALAGRSAA
FT                   KLEAVRSALGPRAADWPVLVANSDDAASLATLAGRTRVVATTVGPYAKYGHALAAACAA
FT                   AGTDYVDLTGEVLFARESIDANHERARETGARIVHSCGFDSIPSDLGVHVLHAKVREDG
FT                   AGELTDTTLVVTSLRGGVSGGTIDSLRTQVDVSKKDAASRRLAASPYSLSPDRSKEPDL
FT                   GKQSDMGVVDGKTIAPGVKGWKAPFFMGPYNTRVVRRSNALRDWAYGREFKYREVMNVG
FT                   SSPITPVIAGAVTAGLGAMIAGMALPPTRYVLDRVLPSPGDGPSEEAQRNGHFTVDLYT
FT                   TTTTGAHYTSRVKAKGDPGYRATAVMLGESALSLVLGGDALPDAAGVLTPATALGDVLV
FT                   ARLRDAGMEISARKL"
     atgacagaca gcgcacgtga attggatctc gtcgtctacg gggccaccgg cttcgtaggc        60
     aaacttctcg ccgactatct tgcacagcac gctccggacg gggtgcggat cgcgctcgcg       120
     ggacggtcgg ccgccaaact ggaagcggtg cggtccgcgc tcggtccgcg cgcggcggac       180
     tggcccgtcc tcgtcgcgaa ctccgacgac gccgcgtcgc ttgccaccct ggcgggacgg       240
     acccgtgtgg tcgcgacgac ggtcggcccc tacgccaagt acggacacgc actcgccgcg       300
     gcctgcgccg cggcgggcac cgactacgtc gacctcaccg gagaagtcct gttcgcccgc       360
     gagagcatcg acgccaacca cgaacgggcc cgcgagaccg gcgcccggat cgtccactcc       420
     tgcggtttcg actccatccc gtccgacctc ggggtgcacg tcctgcacgc gaaggtccgg       480
     gaggacggcg ccggcgaact caccgacacc accctggtgg tcacgtcgct gcgcggcggc       540
     gtcagcggcg gcacgatcga ttcgctccgc actcaggtgg acgtgtcgaa gaaggatgcc       600
     gcctcgcggc gtctcgcggc ctcgccgtac tcgctgagcc ccgaccggtc gaaggaaccc       660
     gatctcggca agcagtccga catgggcgtc gtcgacggca agaccatcgc gcccggcgtc       720
     aagggctgga aggcgccgtt cttcatgggc ccgtacaaca cgcgggtcgt gcggcgcagc       780
     aacgcgctcc gcgactgggc gtacggccgg gaattcaagt accgcgaggt catgaacgtc       840
     ggcagttccc cgatcacgcc ggtgatcgcg ggtgcggtga cggccggcct cggcgcgatg       900
     atcgccggaa tggccctccc gcccacccgg tacgtcctcg accgcgttct gccctcaccg       960
     ggcgacggtc ccagtgagga ggcacaacgc aacggccact tcaccgtcga cctgtacacg      1020
     accaccacca cgggcgcgca ctacacgtcg cgggtgaagg cgaaaggcga ccccggctac      1080
     cgcgccaccg cggtgatgct cggcgaatcc gcgttgagtc tggtgctcgg cggcgacgcg      1140
     ctgccggacg cggcaggcgt tctcaccccg gcgacggcac tcggcgacgt gctggttgca      1200
     cggctgcgcg acgcgggtat ggagatctct gcgcgaaaac tgtga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page