(data stored in ACNUC7421 zone)

EMBL: AP011115.PE633

AP011115.PE633       Location/Qualifiers
FT   CDS_pept        655260..656225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06330"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48880"
FT                   /db_xref="GOA:C1ASU8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU8"
FT                   /protein_id="BAH48880.1"
FT                   /translation="MFKLLIFTLVGVGAQLVDGALGMAFGVTATTLLVFSGVGPAHASA
FT                   AVHFAEVGTTLASGASHWRFRNIDWPLVLRLGVPGAIGAFLGATVLSQLSTAAAVPVTS
FT                   TILLAIGVYVLLRFSIRPPAVNDARTSPHTAKFLSPLGLFGGFIDASGGGGWGPITTST
FT                   LLSRGKTAPRTVIGSVSASEFLVSAAASIGFIFGLGSDFFDNIPIIAGLALGGIIAAPV
FT                   AAWLVSRVPATLLGTGVGGIIIITNAQKLFKTFEVTGVVATLGYIALVAVWAGLLVVAW
FT                   RRSRLSAAEAAGDLHRIDTEIDTPSEPETQSLEPSTGEKA"
     atgttcaagc tcttgatttt cacgctggtc ggcgtgggtg cccagctggt cgacggcgct        60
     ctcggcatgg cgttcggcgt gactgcgacc accctgctcg tgttcagcgg cgtcgggcct       120
     gcccacgcca gcgcagcggt ccacttcgcc gaggtcggca ccacgctcgc ctccggcgcg       180
     tcgcactggc ggttccgcaa catcgactgg ccgctcgtcc tccgcctggg cgtccccggc       240
     gcgatcggcg cgttcctcgg cgcgacggtg ctgtcgcagt tgtcgacggc cgccgccgtc       300
     cccgtgacgt ccacgatcct gctcgcgatc ggcgtctacg tcctcctccg cttctcgatc       360
     cgcccgcccg ccgtcaacga cgcccggacg tcgccgcaca cggcgaagtt cctctcgcca       420
     ctcggactgt tcggcggatt catcgacgcg agcggtggcg gcggctgggg gccgatcacc       480
     accagcacgc tgctgtcgcg gggaaagacc gcaccccgca cggtcatcgg ctcggtcagt       540
     gcgtcggagt tcctggtgtc cgccgcggcc agcatcggat tcatcttcgg gctcggcagc       600
     gacttcttcg acaacatccc catcatcgcg ggtctggcac tcggcggaat catcgccgca       660
     ccggtcgccg cgtggctcgt cagccgggtg cccgccactc ttctcggcac cggtgtcggc       720
     ggcatcatca tcatcaccaa cgcgcagaag ctgttcaaga cgttcgaggt gaccggcgtc       780
     gtcgccaccc tcggctacat tgccctcgtc gcggtctggg ccggactgct cgtcgtcgcc       840
     tggcgccgct cgcgtctcag cgccgcggag gccgcgggcg atctgcaccg gatcgacacc       900
     gagatcgaca cccccagcga gccggaaaca cagtccctgg agccgtccac cggcgagaag       960
     gcctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page