(data stored in ACNUC7421 zone)

EMBL: AP011115.PE635

AP011115.PE635       Location/Qualifiers
FT   CDS_pept        658665..660452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48882"
FT                   /db_xref="GOA:C1ASV0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV0"
FT                   /protein_id="BAH48882.1"
FT                   /translation="MGQHRGESRARGISKGPLIVLGLVVVLVLGVLGWFQLRDRINDQG
FT                   AAAAGACVEGESVLAVAADPDIAPQLQTLADHYAETAPVIRDQCVSVTVTAVASDTVRD
FT                   ALAAGPDGPWDAAAFGPRPALWIPSSSHSVKQLSATGVISGEARPLASSPVVLAVRTAF
FT                   ANAPGTAALDWKDLPSLQSGRDALATLGLPGWGGLGLALPVGPGAESTEMAVEAVAAAV
FT                   TGSSTGPVTEEQARSVPVTSALTDLALGYEASTGAKPATTREALTALAEQGDPATSAIH
FT                   AVATTEQQVYQALRDAPGADITTSMPKGPTPVADHPAAVLAGPAVDETQSRAAAQFAEF
FT                   VRRPEQAQVLADAGFRVEGLARPDDTTLAFPGVESALVPADAAAAAELMQVIRNPISPR
FT                   TSTILLDVSSSMGEREGTSTRLANTTMALAAHVDQSPDSSNLGLWEYSTTLDGSRPYTT
FT                   VVATGPLSAGGFTEGTRRQALDARLARATSATGSSTYTSLEAAYKSAVDGYTPGRTNSV
FT                   LLVTDGANDDSVSRAELLSAIAASSSMSKPVRIDVVTIGENPDLNTLQALADRTGGSLE
FT                   KVTTSDGAALPTAISKLLS"
     gtggggcagc atcgcggcga atcgcgcgcc aggggtatca gcaaggggcc tttgatcgtg        60
     ctcggtctcg tcgtcgtgct cgtgctcggc gtgctgggct ggttccaact gcgtgaccgg       120
     atcaacgatc agggagccgc ggccgccggc gcctgcgtcg aaggcgaatc ggtgctcgcg       180
     gtcgcggcgg atcccgacat cgcaccccag ctgcagactc tcgccgacca ctacgcggag       240
     actgcgccgg tgatacgcga tcagtgcgtg tccgtgacgg tcactgccgt cgcgtccgac       300
     accgtgcgcg acgccctggc cgcgggcccc gacggcccgt gggacgcagc ggcattcgga       360
     ccccgccccg cgctgtggat tccgtccagc tcgcattccg tcaagcagct gtcggcgacc       420
     ggtgtcatca gcggtgaggc acgtccgctg gcgagcagcc cggtggtcct cgccgtccgg       480
     acggcgttcg cgaacgcgcc gggcacggcg gcgctcgact ggaaggactt gccgtccctg       540
     cagtcgggcc gcgacgccct cgcgactctc ggtctgccag gctggggcgg cctgggcctg       600
     gcgctccccg tcggccccgg cgccgagagc accgagatgg ccgtcgaagc ggtcgctgcc       660
     gccgtcaccg gaagcagcac cggtccggtg acggaagagc aggcgcggtc cgttccggtc       720
     acgtcggcac tcaccgacct ggcgctcggc tacgaggctt cgaccggggc gaaacccgcg       780
     acgacgcggg aggcgctcac cgcgctcgcc gagcagggcg accccgccac ctccgccatc       840
     catgcggtcg cgaccaccga acagcaggtc tatcaggccc tgcgcgacgc acccggagca       900
     gatatcacca catcgatgcc gaaaggcccg acacccgtgg cagatcaccc ggcagccgtc       960
     ctggcgggcc cggccgtcga cgagacgcag agccgcgccg ccgcgcagtt cgcggaattc      1020
     gtccgtcgac ccgaacaggc gcaggtcctg gccgacgccg gtttccgggt cgagggactc      1080
     gcccgcccgg acgacaccac gctggccttt cccggtgtcg agtccgccct ggttcccgcg      1140
     gacgcggccg ctgcggccga gctgatgcag gtgatccgga atccgatctc gccgcgcacg      1200
     tccaccatcc tgctcgacgt ctccagttcg atgggtgaac gcgaggggac gtcgacgcga      1260
     ctggcgaaca cgacgatggc gctggccgcc catgtggatc agtctccgga ttcgtcgaac      1320
     ctcggattgt gggagtacag caccaccctc gacgggtcca ggccgtacac gaccgtcgtc      1380
     gccaccgggc ccctgtcggc gggcggtttc accgagggca cccgcaggca ggccttggac      1440
     gcccggctcg ccagggcgac gtccgccacc ggatcctcga cgtacacctc gctcgaggcc      1500
     gcctacaaga gtgccgtcga cggatacaca ccgggccgca ccaattcggt tctgctcgtc      1560
     accgacggcg ccaacgacga ctccgtgtcg cgtgcggagc tgctgtctgc catcgccgcg      1620
     tcctcgagta tgtcgaagcc ggtccgcatc gacgtggtga cgatcggcga gaatcccgac      1680
     ctcaacacat tgcaggcact cgccgatcgc accggcggct cgttggagaa ggtcacgact      1740
     tcggacggag cggccttgcc gaccgcgatc agcaagctgc tgtcgtga                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page