(data stored in ACNUC7421 zone)

EMBL: AP011115.PE636

AP011115.PE636       Location/Qualifiers
FT   CDS_pept        660449..661603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48883"
FT                   /db_xref="GOA:C1ASV1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV1"
FT                   /protein_id="BAH48883.1"
FT                   /translation="MTRLLVFAVFLALVTWWLHRRLVRATGLGRPWSVIVDLALVALWV
FT                   LAVIGVGSGEAFDPGWARPPGWAGWVWLGAMFYLVLGLLLVAVVSLLTRLFARVRGGGH
FT                   DEQVDLSRRRGLRIATAVVVVGAVGAAGYGVREAARPRIVRVRVPLQRLPAEFEGVRVA
FT                   LVSDLHVGPARGVDFTRRVVDLVNAERPDLVAIAGDLVDGTVAKVAPDLQPLGDLEAPL
FT                   GVFGVSGNHEFYADDGGRWLDVWDRLGIRTLRNEHATLTRGGAAIDIAGIHDYSSPAPY
FT                   EPDLPAALAGRDPSTFVVLLAHEPRQALEASDLGVDLQLSGHTHGGQMWPLGYLVPLQQ
FT                   PSVTGLDRIGNTVLYTTRGVGAWGPPVRVGAPPEITILELVRAD"
     gtgacgagac tcctggtctt cgcggtcttc ctcgcgctcg tcacctggtg gcttcaccgt        60
     cggctcgtcc gggccaccgg attgggccgc ccctggtcgg tgatcgtcga cctggccctc       120
     gtcgccttgt gggtgctcgc cgtcatcggc gtgggcagcg gcgaagcctt cgaccccgga       180
     tgggcgcgac caccggggtg ggcgggctgg gtgtggctcg gcgcgatgtt ctatctggtg       240
     ctcggacttc tcctggtcgc cgtggtgtcg ctgctcaccc ggctgttcgc ccgcgtgcgc       300
     ggcggagggc acgacgaaca ggtcgatctg tcgcgtcggc gaggtctgcg catcgccacc       360
     gcggtcgtgg tggtgggtgc cgtcggcgcc gccggctacg gggttcggga ggccgctcgt       420
     ccacggatcg tgcgggttcg ggtaccgctg cagcgcctcc ccgccgagtt cgagggtgtg       480
     cgcgtggcgc tcgtctccga cctgcacgtc ggcccggcgc gaggagtcga cttcacgcgc       540
     cgggtggtcg atctcgtgaa cgcggagcgg ccggatctcg tcgcgatcgc gggcgatctg       600
     gtcgacggga ccgtcgcgaa ggtcgcgccc gacctacagc cgctcggcga cctcgaggcc       660
     ccgctcgggg tgttcggggt cagcggcaac cacgagttct acgccgacga cggtggccgc       720
     tggctggatg tgtgggaccg actgggcatc aggacgctgc gcaacgagca cgcgaccctc       780
     acccggggcg gcgccgccat cgacatcgcg ggcatccacg actattcgtc gccggcgccg       840
     tacgagccgg acctccctgc cgcactcgcg gggcgcgatc cgtcgacatt cgtggtgctg       900
     ctcgcccacg aaccgcggca ggccctggaa gcctcggatc tcggtgtgga cctgcaactg       960
     tcggggcaca cgcacggcgg ccagatgtgg ccgctgggtt atctggtgcc gctgcagcag      1020
     ccgtcggtga cgggactcga ccgcatcggc aacaccgtcc tctacacgac ccgcggcgtc      1080
     ggcgcgtggg gtccgcccgt gcgggtgggc gccccaccgg agatcacgat cctcgaactg      1140
     gtgcgcgcgg actga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page