(data stored in ACNUC7421 zone)

EMBL: AP011115.PE64

AP011115.PE64        Location/Qualifiers
FT   CDS_pept        complement(54271..54684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48311"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS62"
FT                   /protein_id="BAH48311.1"
FT                   /translation="MCAAKVASSVMQVAELDRSVKYYCDVFGCRVAVREPDAALLLTPD
FT                   NFQIYMYAKKGASTRRGVSVIGVHYVMWAADTEDELERITERLHAYDATTYTQTVGGVT
FT                   FVDGCDPDGIRVIVAYPGPEQLPRELIAQRFRG"
     atgtgcgctg ccaaggttgc ctcgtcggtg atgcaagtgg ccgagctgga tcggtcggtg        60
     aagtactact gcgacgtctt cggctgccgt gtcgcggtgc gcgagcccga tgcagcactc       120
     cttctgacgc cggacaactt tcagatctac atgtatgcga agaagggggc atcgacccgt       180
     cgcggggtaa gcgtcatcgg cgtgcactac gtcatgtggg ccgccgacac cgaggacgag       240
     ttggagcgga tcaccgagcg gctacacgca tatgacgcga ccacgtacac gcagacggtc       300
     ggcggggtga cgttcgtgga tggttgcgac ccggacggca tccgtgtcat cgtcgcctac       360
     ccgggccccg agcagctacc gcgggagctg atcgcgcaac gattccgcgg gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page