(data stored in ACNUC7421 zone)

EMBL: AP011115.PE643

AP011115.PE643       Location/Qualifiers
FT   CDS_pept        complement(668385..669131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48890"
FT                   /db_xref="GOA:C1ASV8"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV8"
FT                   /protein_id="BAH48890.1"
FT                   /translation="MSGHEGRHELHGTEPTTSRRSHVVFALLAALLLGGLGIAIVTQVK
FT                   NTGSGDTLDSASPADLLVVLDTLNQREAALRQEIASLEQTLATLQQSGSSGAALDEAQA
FT                   RLTALSIQVGSAPATGPGVTMRITDPNRGVGSEVLLDLVQELRAAGAEAIQVQGADGPP
FT                   IRIGVDSWVSGSAGGVSVDGRKVNAPYGVVAIGDPPTLAAALNIPGGVVDTVARSGGQL
FT                   TIEQSQQVTISALREAKPRQYAQPGN"
     gtgagcgggc acgagggcag acacgaactg cacggcaccg aacccacgac gtcgcggcgc        60
     tcacacgtcg tcttcgcgct gctggccgcg ctccttctcg gcgggctggg aatcgcgatc       120
     gtgacgcagg tgaagaacac cgggtccggc gacacgctcg actcggcgag ccccgcggat       180
     ctgctggtcg tcctggacac gctgaatcag cgggaggcgg ccctgcggca ggagatcgca       240
     tcgctggaac agaccttggc aaccttgcaa cagagcggca gttccggggc ggcgctcgac       300
     gaggcgcagg cccggctgac ggccctgtcg atccaggtcg ggagcgcacc ggccaccggc       360
     cccggagtga cgatgcgcat caccgacccc aacagggggg tcggatccga ggtcctgctc       420
     gacctcgtcc aggagctccg cgccgccggc gccgaagcca tccaggtcca gggtgccgac       480
     ggcccaccca tccggatcgg cgtcgactcc tgggtgtccg gctcggcagg cggcgtgtcg       540
     gtggacggcc gcaaggtgaa cgccccctac ggagttgtcg ccatcggtga tccgccgact       600
     ctggcggcgg ccctgaacat tcccggcggg gtggtcgaca cggtcgcccg cagcggtgga       660
     cagttgacga tcgaacaatc gcagcaggtc acgatctccg ccttgcggga ggcgaaacct       720
     cgccaatacg ctcagcccgg aaattga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page