(data stored in ACNUC7421 zone)

EMBL: AP011115.PE644

AP011115.PE644       Location/Qualifiers
FT   CDS_pept        complement(669139..669501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48891"
FT                   /db_xref="GOA:C1ASV9"
FT                   /db_xref="InterPro:IPR009709"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV9"
FT                   /protein_id="BAH48891.1"
FT                   /translation="MKAALKGGSAIYGVLALIVGIVLGVVFSPQVPDAVQPYLPIAVVA
FT                   ALDAVFGGLRAYLDEIFDSKVFVVSFVFNVLVAALIVWLGDQLGVGTQLSTAIVVVLGI
FT                   RIFGNAAALRRRLFGA"
     atgaaggcag cgctgaaggg cggatccgcg atctacgggg tgctcgccct gatcgtggga        60
     atcgtgctgg gagtggtgtt cagcccgcaa gtgcccgatg ccgtgcagcc ctacctgccc       120
     atcgccgtcg tcgccgcgct cgacgcggtg ttcggcgggt tgcgcgcata cctcgacgag       180
     atcttcgact cgaaggtgtt cgtcgtctcg ttcgtgttca acgtcctcgt ggcggcgctg       240
     atcgtgtggc tcggtgacca actcggtgtc gggacccagc tgtccaccgc gatcgtcgtc       300
     gtgctcggca tccgcatctt cggcaacgcg gccgcgctgc ggcggcgtct gttcggggcg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page