(data stored in ACNUC7421 zone)

EMBL: AP011115.PE645

AP011115.PE645       Location/Qualifiers
FT   CDS_pept        complement(669534..670397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48892"
FT                   /db_xref="GOA:C1ASW0"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW0"
FT                   /protein_id="BAH48892.1"
FT                   /translation="MKRTESGVRRNPVPSLLQSLMNDHLDPGYEGAAEDREHGHSRQTR
FT                   VGRQVWIAIGALLVGLVLSVAYRQATERIPGTEQVRSELLSKVQDAEDRAGALAATRDT
FT                   LSAQADDARATALAGDARGAALLDELRGLEGDAGVEAVHGPGLTVTLTDPAAKPNLSDS
FT                   SQRSVGGKAVVLDRDLQSVVNSLWAGGAEAIAVGDVRIGPSVTIRQAGGAMLVDNQPVF
FT                   SPYVVSAIGPQGPMQTGFVVSDAYLRMSSVAQLYGIGFAVAEADDLHLPAAPAREVRAA
FT                   REAGTR"
     atgaagcgga ccgagtccgg cgttcgcagg aatccggtgc cgtccctgct gcagtctctg        60
     atgaacgatc atctggaccc cggctacgag ggtgcggcag aggatcgcga gcacgggcat       120
     tcgcggcaga cacgggtcgg ccggcaggtg tggatcgcga tcggtgcact gctcgtgggc       180
     ctggtgctgt cggtcgccta ccggcaggcc accgaacgca tcccgggcac cgagcaggtg       240
     cgctccgaac tgctgagcaa ggtgcaggac gcggaggacc gggccggtgc gctcgcggct       300
     acccgggaca cgttgtcggc gcaggccgac gacgcccggg ccaccgcgct ggccggggac       360
     gctcgcggtg ccgcgctgct cgacgagcta cgggggctcg agggggacgc cggggtcgag       420
     gccgtgcacg gtcccggact gaccgtgacg ctcacggacc ccgcggccaa gcccaacctg       480
     tccgactcgt cccagcgcag tgtcgggggg aaggcggtgg tgctcgatcg cgacctgcag       540
     tcggtggtca actcgctgtg ggcgggcggt gccgaggcca tcgcggtcgg cgacgtgcgg       600
     atcggcccgt cggtgacgat ccggcaggcg ggaggcgcga tgctcgtgga caaccagccg       660
     gtgttctcgc cgtacgtggt ctccgccatc ggcccgcagg gacccatgca gaccggattc       720
     gtggtgagcg acgcctacct gcggatgtcc agcgtggcgc agttgtacgg catcggattc       780
     gcggtcgcgg aggccgacga tctccacttg cccgccgccc cggcgcggga agtgcgggca       840
     gcccgggaag caggaacacg atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page