(data stored in ACNUC7421 zone)

EMBL: AP011115.PE648

AP011115.PE648       Location/Qualifiers
FT   CDS_pept        complement(672253..672873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48895"
FT                   /db_xref="GOA:C1ASW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW3"
FT                   /protein_id="BAH48895.1"
FT                   /translation="MMVDGHVLSRERLADALARFEPRIVDPTNRRSAAVVIAVMNDGAD
FT                   GQAVPLTRRPSKMRAHPGQFALPGGGVDPGETGADAARRELHEELGLDVGPSAVLGRLD
FT                   DYVTRSGYVITPFVVWSEQSIASLVPNHEEVAEVFSVGVAEIDAEPRFVEIPESSKPVI
FT                   QWPFRRHLVHAPTGAVVYQFREVALHDRHTRIDGFDQPVFAWR"
     gtgatggtgg atgggcacgt actcagcagg gaacggctcg ccgacgcgct ggcacgattc        60
     gaacctcgga tcgtggaccc gacgaaccgg cggtccgcgg cggtcgtgat cgccgtgatg       120
     aacgacggcg cggacggtca ggccgttccg ctgaccaggc gaccgagcaa gatgcgcgcg       180
     catccggggc agttcgcgtt gcccggtggc ggggtggatc cgggggagac cggcgcggac       240
     gccgcccggc gcgaactgca cgaggaactc ggcctcgacg tggggccgtc cgcggtactc       300
     ggcagactcg acgactacgt cacccgctcc ggatacgtca tcacgccctt cgtcgtgtgg       360
     tcggagcagt cgatcgcctc gctggtcccc aatcacgagg aagtggcgga agtgttctcg       420
     gtgggcgtcg ccgagatcga tgccgagccg cgattcgtgg agattcccga atcgtcgaag       480
     ccggtgatcc agtggccgtt ccggcgtcac ctcgtgcacg ccccgacggg cgcggtcgtg       540
     taccagttcc gggaggtcgc gctgcacgac cggcacaccc ggatcgacgg tttcgaccaa       600
     cccgtcttcg cctggcggta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page