(data stored in ACNUC7421 zone)

EMBL: AP011115.PE649

AP011115.PE649       Location/Qualifiers
FT   CDS_pept        complement(672952..674472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06490"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48896"
FT                   /db_xref="GOA:C1ASW4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW4"
FT                   /protein_id="BAH48896.1"
FT                   /translation="MRLTDYLDKGASLGPSSPCLTMGERTLSYADVQDLSRRVAAALAR
FT                   SGIAAGDKVAVLSGNDPTAFSCVFGISRAGAVWCPINPRNEAAENRDLLDLFDCRCLIF
FT                   QKAFAPLVDRIREQLPLLTTLVCLDGDETYAESFDTWLGAARLDAEPVDDLALIVGTGG
FT                   TTGRPKGVMLTGRNIETMSALTLMSYPFDGRPVYLALAPLTHAAGVLCFPILTLGGQVV
FT                   IMPAPDLGQFLAHIDRDRVTHTFLPPTLIYMLLDHADLETTDLGSLQCFWYGAAPISPT
FT                   RLSEALTRIGPVMAQLFGQSEAPMMIATMAPKDHFHEDGSVATARLSSAGRPSPLVTVA
FT                   IMDGQGILLPAGERGEVVVRSSLVMAGYYKNPVATQEASAHGWHHTGDIGYLDEDNFLY
FT                   IVDRAKDMIITGGFNVYSVEVEQALMAYPGIQDCGVIGLPDEKWGERVVAVVQARAGTP
FT                   IEADALTAFVKARIGSVKTPKEILVWPDLPRSKLGKVLKNEIRQQLLG"
     atgcgcttga ccgactacct cgacaagggc gcctcgctcg gaccgtcgtc gccgtgcctg        60
     acgatgggcg agcggacgct gtcgtacgcg gacgtccagg acctcagccg gcgggtcgcc       120
     gcggcgctgg cacggtcggg gatcgccgcg ggcgacaagg tggccgtcct gtccggcaac       180
     gatccgaccg cgttctcctg cgtgttcggg atcagccggg cgggggcggt gtggtgcccg       240
     atcaatcccc ggaacgaggc ggcggagaat cgggacctgc tcgacctctt cgactgccgc       300
     tgcctgatct tccagaaggc gttcgcgccc ttggtcgatc ggatccggga gcagttgccg       360
     ctgctcacga cgctcgtgtg cctcgacggc gacgagacgt acgccgaatc cttcgacacc       420
     tggctgggtg ccgcacgcct cgacgccgag cccgtcgacg acctcgcgct gatcgtcggt       480
     accggcggga cgacgggacg cccgaagggg gtgatgctca ccggccggaa catcgagacg       540
     atgtccgcgt tgaccctgat gagttacccg ttcgacggca gaccggtgta cctcgcgctc       600
     gcgccgttga cccacgcggc gggtgtcctg tgctttccga tcctcaccct cggcgggcag       660
     gtggtcatca tgcccgcgcc cgatctcggg cagttcctcg cgcacatcga ccgggaccgc       720
     gtcacccaca ccttcctccc accgaccctg atctacatgc tgctcgacca cgccgacctg       780
     gagacgacgg acctcggttc gctgcaatgc ttctggtacg gcgcggcgcc gatctcgccg       840
     acgcggctga gcgaggcgct gacccggatc gggccggtga tggcccagct gttcgggcag       900
     agcgaggcac cgatgatgat cgcgacgatg gcgccgaaag accacttcca cgaggacggc       960
     tcggtggcga ccgcccggtt gagctccgcg ggccgaccct ccccgctggt cacggtggcg      1020
     atcatggacg ggcagggaat cctgctgccg gcaggtgaac gaggcgaagt ggtcgtgcgc      1080
     agctcactcg tcatggcggg gtactacaag aatcccgttg cgacgcagga ggcatcggca      1140
     cacggctggc atcacaccgg cgacatcgga tacctcgacg aggacaactt cctgtacatc      1200
     gtcgaccgtg ccaaggacat gatcatcacc ggcggattca acgtctattc cgtcgaagtg      1260
     gaacaggcgc tcatggcgta tccggggatc caggactgcg gggtgatcgg gctccccgac      1320
     gagaagtggg gcgaacgcgt cgtcgccgtc gtccaggcgc gggccggaac accgatcgag      1380
     gccgacgcgc tcacggcgtt cgtgaaggcg cgcatcggca gcgtcaagac cccgaaggag      1440
     atcctggtct ggcccgatct gcctcgttcc aaactcggga aggtcctcaa gaacgagatc      1500
     aggcagcaat tgctcggctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page