(data stored in ACNUC7421 zone)

EMBL: AP011115.PE65

AP011115.PE65        Location/Qualifiers
FT   CDS_pept        55023..55382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00650"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48312"
FT                   /db_xref="GOA:C1AS63"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS63"
FT                   /protein_id="BAH48312.1"
FT                   /translation="MPESLYQPTTTEISERRKALAPGIHDAFENFSRAVFADGALPEKT
FT                   KQLIAVAVAHVTQCPYCITGHTKLARRKGAEPEEIMEAIWVAAEMRAGGAFAHSTLALN
FT                   AMNHSGHTSTGEPEP"
     atgcccgagt cgctgtatca gcccaccacg acggagattt cggaacgtcg caaggcgctc        60
     gcacccggga ttcacgacgc cttcgagaat ttcagtcgcg ccgtcttcgc cgacggtgcg       120
     ctgccggaga agacgaaaca gctcatcgcg gtcgcggtcg cccatgtgac gcagtgcccg       180
     tactgcatca ccgggcacac caaactggcc cgccgcaagg gcgccgaacc ggaggaaatc       240
     atggaagcca tctgggtcgc ggcggaaatg cgggccggtg gtgcgttcgc gcactccacg       300
     ctggccctga acgcgatgaa ccatagtggc cacacctcta caggggagcc cgaaccgtga       360
//

If you have problems or comments...

PBIL Back to PBIL home page