(data stored in ACNUC7421 zone)

EMBL: AP011115.PE653

AP011115.PE653       Location/Qualifiers
FT   CDS_pept        complement(677323..677763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48900"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW8"
FT                   /protein_id="BAH48900.1"
FT                   /translation="MAGRFEGTVVIDRPIEEVFEYLAAGVNDREFSPRVQEIVKKTDGP
FT                   PGVGTVFVSTVKDAGMTTKREFEITEFEAPRRIRWAERSTNTVTAKEGGYDLEPSGAGT
FT                   KVTIFNVLEGHGIGRLIAPLALRAARKDAPAFAQRIKVAAEK"
     atggctggac ggttcgaagg cactgtggtg atcgatcgcc ccatcgagga agtgttcgag        60
     tacctcgccg ccggggtcaa cgaccgggag ttcagtccgc gggtccagga gatcgtgaag       120
     aagaccgacg ggccgcccgg agtcggcacc gtcttcgtca gcaccgtcaa ggatgcggga       180
     atgaccacga agcgggagtt cgagatcacc gaattcgagg cgccgcggag gattcgctgg       240
     gcggagcgat cgacgaacac cgtgaccgcg aaagagggcg gctacgatct cgaaccgtcg       300
     ggcgcgggca ccaaggtgac gatcttcaac gtgctggagg ggcacggaat cggaagactg       360
     atcgcgcccc tcgcactgcg ggcggcacgc aaggacgcac ccgcgttcgc ccagcggatc       420
     aaggtcgccg cggagaagtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page