(data stored in ACNUC7421 zone)

EMBL: AP011115.PE654

AP011115.PE654       Location/Qualifiers
FT   CDS_pept        677762..678091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06540"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48901"
FT                   /db_xref="GOA:C1ASW9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW9"
FT                   /protein_id="BAH48901.1"
FT                   /translation="MPASRFRDLPGSDSTRAEAGARSHRRRAVGHRSDAAARTIGETVG
FT                   AFVLIAAVATSRSRYVMATNSPVAEALTSGFQRVLLASSIFLVAAALIALRTGNTRGDC
FT                   TARTK"
     atgccagcct cccgtttccg tgacctgccg ggttccgaca gtactcgcgc cgaggccggt        60
     gcgcggtcac atcgccgccg ggccgtcggt catagaagtg acgccgccgc ccgcaccatc       120
     ggcgagaccg tcggagcgtt cgtgctgatc gccgccgtcg cgacctcgcg gtcccggtac       180
     gtgatggcaa cgaattcccc tgtggccgag gcactcacct ccggttttca gcgagtgtta       240
     ctggcgagca gcatcttcct cgtcgccgca gcactgatcg cgctgcgcac cggcaacacc       300
     cgcggagact gcacggcgcg aacgaaatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page